NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004178

3300004178: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 14_LOW5



Overview

Basic Information
IMG/M Taxon OID3300004178 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111074 | Ga0066410
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metagenome 14_LOW5
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size223726592
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001089Metagenome / Metatranscriptome781Y
F010093Metagenome308Y
F021521Metagenome / Metatranscriptome218Y
F097602Metagenome / Metatranscriptome104Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066410_1015738All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae1178Open in IMG/M
Ga0066410_1020810All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1023Open in IMG/M
Ga0066410_1022037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales995Open in IMG/M
Ga0066410_1091256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066410_1015738Ga0066410_10157382F001089VTPAESGYVLQLASLSLSFVGFSALVVTLRGALGGDLSDRHLRLVRRYIEGGLLVTALALVPTLLNLLHIPDTVTWALSSAATALIFSFVLLIQFRRRRTVEAGRFPPWTIIVYAVSIVVIVGLWLNVAGIPFPPSVGPYAVALTWAICVFGFIFVRTIELFLHREV*
Ga0066410_1020810Ga0066410_10208102F097602GRSNCDSLSPKRSSNADVMNRGSTDEAVVVVKVGADEFMVTWGRVKHRNSNRMLEAKGGTCKRPWPLIKDRRVEISQTGAVDYSRREQ*
Ga0066410_1022037Ga0066410_10220372F021521VIATDPTPFAKKEKMAGYSHRTAQPPILAVFLPWGVSAGAGRMRPAAAKVRFEN*
Ga0066410_1091256Ga0066410_10912561F010093RITNFAQYRNQEFEKKYYTDLFIPAIYKAYDLTCQLNLDTSNHSDPFKMEKITVHHDVLSGNDALLFRNNMGAALALRIERLNRSLDAFSDARAACVEMEKLIMKKLGVKSTS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.