NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F088984

Metagenome / Metatranscriptome Family F088984

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F088984
Family Type Metagenome / Metatranscriptome
Number of Sequences 109
Average Sequence Length 83 residues
Representative Sequence VFDRFISISLWCAQVTVTPDARRTAVLSSGTLNGLRGLIPVGGQQHPSSGVGASLLWKNAQKNAKKNRTSDVINRIIPHRKPFVT
Number of Associated Samples 97
Number of Associated Scaffolds 109

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 49.50 %
% of genes near scaffold ends (potentially truncated) 22.02 %
% of genes from short scaffolds (< 2000 bps) 84.40 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (77.064 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(38.532 % of family members)
Environment Ontology (ENVO) Unclassified
(33.028 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(41.284 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.74%    β-sheet: 0.00%    Coil/Unstructured: 67.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 109 Family Scaffolds
PF00510COX3 7.34
PF02790COX2_TM 2.75
PF00119ATP-synt_A 1.83
PF00361Proton_antipo_M 0.92
PF00499Oxidored_q3 0.92

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 109 Family Scaffolds
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 7.34
COG1622Heme/copper-type cytochrome/quinol oxidase, subunit 2Energy production and conversion [C] 2.75
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 1.83
COG0839NADH:ubiquinone oxidoreductase subunit 6 (chain J)Energy production and conversion [C] 0.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A77.06 %
All OrganismsrootAll Organisms22.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000121|TDF_OR_ARG04_113mDRAFT_c1001332All Organisms → cellular organisms → Eukaryota3841Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1033666Not Available1108Open in IMG/M
3300000917|WSSedA2C3DRAFT_1000088All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Psathyrellaceae → Drosophila12024Open in IMG/M
3300001806|JGI20216J20342_1003176Not Available838Open in IMG/M
3300002662|Ga0005456J37224_107348Not Available634Open in IMG/M
3300002668|Ga0005482J37270_107472Not Available597Open in IMG/M
3300003151|Ga0051092_1000525All Organisms → cellular organisms → Eukaryota → Opisthokonta4484Open in IMG/M
3300003550|Ga0007425J51702_100363All Organisms → cellular organisms → Eukaryota948Open in IMG/M
3300004101|Ga0058896_1373019Not Available517Open in IMG/M
3300004104|Ga0058891_1001737Not Available737Open in IMG/M
3300004135|Ga0058884_1261394Not Available602Open in IMG/M
3300004340|Ga0066239_1005991All Organisms → cellular organisms → Eukaryota → Opisthokonta614Open in IMG/M
3300005095|Ga0072504_101697All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria16068Open in IMG/M
3300006356|Ga0075487_1024513Not Available541Open in IMG/M
3300007232|Ga0075183_11353601Not Available710Open in IMG/M
3300007526|Ga0075022_1493366Not Available751Open in IMG/M
3300008035|Ga0099808_1065390All Organisms → cellular organisms → Eukaryota → Opisthokonta843Open in IMG/M
3300008038|Ga0099805_1554179Not Available880Open in IMG/M
3300008042|Ga0100406_1562249Not Available712Open in IMG/M
3300008832|Ga0103951_10255788All Organisms → cellular organisms → Eukaryota → Opisthokonta884Open in IMG/M
3300008832|Ga0103951_10693644Not Available555Open in IMG/M
3300008998|Ga0103502_10152786All Organisms → cellular organisms → Eukaryota → Opisthokonta837Open in IMG/M
3300009586|Ga0115591_1050019Not Available815Open in IMG/M
3300009721|Ga0123358_14544Not Available847Open in IMG/M
3300009730|Ga0123359_160170All Organisms → cellular organisms → Eukaryota → Opisthokonta760Open in IMG/M
3300010033|Ga0126339_10001545All Organisms → cellular organisms → Eukaryota → Opisthokonta15742Open in IMG/M
3300010854|Ga0126360_1039428Not Available801Open in IMG/M
3300012356|Ga0137371_10002377All Organisms → cellular organisms → Eukaryota → Opisthokonta15002Open in IMG/M
3300018585|Ga0193221_1008320All Organisms → cellular organisms → Eukaryota → Opisthokonta649Open in IMG/M
3300018641|Ga0193142_1028108Not Available808Open in IMG/M
3300018661|Ga0193122_1060948Not Available524Open in IMG/M
3300018723|Ga0193038_1009516Not Available1313Open in IMG/M
3300018723|Ga0193038_1067780Not Available547Open in IMG/M
3300018747|Ga0193147_1037600All Organisms → cellular organisms → Eukaryota → Opisthokonta822Open in IMG/M
3300018835|Ga0193226_1057563Not Available906Open in IMG/M
3300018835|Ga0193226_1058279All Organisms → cellular organisms → Eukaryota → Opisthokonta900Open in IMG/M
3300018934|Ga0193552_10109271All Organisms → cellular organisms → Eukaryota → Opisthokonta775Open in IMG/M
3300018934|Ga0193552_10134027Not Available703Open in IMG/M
3300018934|Ga0193552_10158226All Organisms → cellular organisms → Eukaryota → Opisthokonta645Open in IMG/M
3300018951|Ga0193128_10111266All Organisms → cellular organisms → Eukaryota → Opisthokonta661Open in IMG/M
3300018958|Ga0193560_10157923Not Available721Open in IMG/M
3300018963|Ga0193332_10196593Not Available641Open in IMG/M
3300018971|Ga0193559_10138089Not Available796Open in IMG/M
3300019039|Ga0193123_10201692Not Available781Open in IMG/M
3300019039|Ga0193123_10270724Not Available667Open in IMG/M
3300019044|Ga0193189_10116561All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Elopocephalai → Elopocephala → Elopomorpha → Anguilliformes → Anguillidae → Anguilla → Anguilla anguilla640Open in IMG/M
3300019186|Ga0184588_124732Not Available583Open in IMG/M
3300019232|Ga0180114_1160665Not Available1135Open in IMG/M
3300019487|Ga0187893_10073702All Organisms → cellular organisms → Eukaryota → Opisthokonta3206Open in IMG/M
3300021967|Ga0213848_1230714Not Available547Open in IMG/M
3300022498|Ga0242644_1014035Not Available749Open in IMG/M
3300022501|Ga0242645_1019101Not Available596Open in IMG/M
3300022511|Ga0242651_1014052Not Available782Open in IMG/M
3300022511|Ga0242651_1016312Not Available744Open in IMG/M
3300022523|Ga0242663_1083532Not Available614Open in IMG/M
3300022712|Ga0242653_1074029Not Available589Open in IMG/M
3300022717|Ga0242661_1057085Not Available742Open in IMG/M
3300024220|Ga0224568_1003752Not Available1507Open in IMG/M
3300030525|Ga0210273_1302209Not Available800Open in IMG/M
3300030531|Ga0210274_1466843Not Available1157Open in IMG/M
3300030533|Ga0247632_1005429Not Available741Open in IMG/M
3300030539|Ga0210281_1158489Not Available801Open in IMG/M
3300030551|Ga0247638_1058822Not Available767Open in IMG/M
3300030564|Ga0210256_10797799Not Available864Open in IMG/M
3300030565|Ga0247635_1088140Not Available761Open in IMG/M
3300030573|Ga0210272_1012623Not Available1087Open in IMG/M
3300030575|Ga0210288_1039254Not Available903Open in IMG/M
3300030585|Ga0247639_1232972All Organisms → cellular organisms → Bacteria → Proteobacteria564Open in IMG/M
3300030591|Ga0247626_1150509Not Available636Open in IMG/M
3300030594|Ga0210280_1021721Not Available887Open in IMG/M
3300030628|Ga0247629_10351742Not Available551Open in IMG/M
3300030632|Ga0210250_10414516Not Available744Open in IMG/M
3300030776|Ga0075396_1055475Not Available771Open in IMG/M
3300030777|Ga0075402_12305063Not Available536Open in IMG/M
3300030777|Ga0075402_12338121Not Available731Open in IMG/M
3300030779|Ga0075378_10023486Not Available737Open in IMG/M
3300030790|Ga0138304_1019711Not Available608Open in IMG/M
3300030841|Ga0075384_11139900Not Available736Open in IMG/M
3300030845|Ga0075397_10455533Not Available501Open in IMG/M
3300030847|Ga0075405_10009678Not Available738Open in IMG/M
3300030847|Ga0075405_10036645Not Available1303Open in IMG/M
3300030848|Ga0075388_10069149All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Actinopterygii → Actinopteri → Neopterygii → Teleostei → Elopocephalai → Elopocephala → Elopomorpha → Anguilliformes → Anguillidae → Anguilla → Anguilla anguilla570Open in IMG/M
3300030852|Ga0075389_10058137Not Available1343Open in IMG/M
3300030854|Ga0075385_10039523Not Available639Open in IMG/M
3300030923|Ga0138296_1640450Not Available577Open in IMG/M
3300030939|Ga0138303_1249545Not Available724Open in IMG/M
3300030974|Ga0075371_10093586All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Collembola → Entomobryomorpha → Isotomoidea → Isotomidae → Proisotominae → Folsomia → Folsomia candida508Open in IMG/M
3300030974|Ga0075371_10811018Not Available1245Open in IMG/M
3300030996|Ga0074004_10852015Not Available509Open in IMG/M
3300031015|Ga0138298_1604339All Organisms → cellular organisms → Eukaryota1059Open in IMG/M
3300031015|Ga0138298_1691851Not Available792Open in IMG/M
3300031167|Ga0308023_1101548Not Available527Open in IMG/M
3300031231|Ga0170824_125674837Not Available565Open in IMG/M
3300031446|Ga0170820_11768357Not Available786Open in IMG/M
3300031469|Ga0170819_12525817Not Available759Open in IMG/M
3300031628|Ga0308014_1014028Not Available2129Open in IMG/M
3300031868|Ga0316038_114319Not Available558Open in IMG/M
3300032273|Ga0316197_10261351Not Available978Open in IMG/M
3300032651|Ga0314685_10433345Not Available727Open in IMG/M
3300032666|Ga0314678_10009693All Organisms → cellular organisms → Eukaryota → Opisthokonta2093Open in IMG/M
3300032829|Ga0335070_11992198Not Available523Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil38.53%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine19.27%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.59%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil3.67%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral3.67%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.75%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.75%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland1.83%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.83%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.92%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland0.92%
Mangrove SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment0.92%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment0.92%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.92%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine0.92%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.92%
Hydrothermal Fe-Rich MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat0.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.92%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.92%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.92%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.92%
Alvinella Pompejana EpibiontHost-Associated → Annelida → Integument → Cuticle → Epibionts → Alvinella Pompejana Epibiont0.92%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent0.92%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.92%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000121Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3mEnvironmentalOpen in IMG/M
3300000125Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 01_11.3mEnvironmentalOpen in IMG/M
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300000917Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A2 CattailEnvironmentalOpen in IMG/M
3300001806Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300002662Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF105 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300002668Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF131 (Metagenome Metatranscriptome, Counting Only)EnvironmentalOpen in IMG/M
3300003151Alvinella pompejana epibiont microbial communities from the East Pacific Rise hydrothermal ventHost-AssociatedOpen in IMG/M
3300003550Grassland soil microbial communities from Hopland, California, USA - Sample H3_Bulk_41 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004101Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004135Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004340Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC4AEnvironmentalOpen in IMG/M
3300004618Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005095Hydrothermal chimney microbial communities from the East Pacific Rise - L vent 8EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007232Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007526Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008035Coral microbial communities from Puerto Morelos, Mexico - Orbicella T R B metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008038Coral microbial communities from Puerto Morelos, Mexico - Orbicella C B metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008042Coral microbial communities from Puerto Morelos, Mexico - Orbicella 8 C C metatranscriptome (Eukaryote Community Metatranscriptome)Host-AssociatedOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009586Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009721Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_174_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009730Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_177_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009757Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_205_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010033Coral microbial communities from Petempiche,Puerto Morelos, Mexico - Orbicella T R C metagenomeHost-AssociatedOpen in IMG/M
3300010138Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010854Boreal forest soil eukaryotic communities from Alaska, USA - W4-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300018585Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000269 (ERX1782265-ERR1712044)EnvironmentalOpen in IMG/M
3300018641Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782156-ERR1711909)EnvironmentalOpen in IMG/M
3300018661Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782311-ERR1712063)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018835Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_047 - TARA_N000000284 (ERX1782152-ERR1712198)EnvironmentalOpen in IMG/M
3300018934Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003183EnvironmentalOpen in IMG/M
3300018951Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001338 (ERX1782096-ERR1711860)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018971Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003148EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019044Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789478-ERR1719328)EnvironmentalOpen in IMG/M
3300019186Soil microbial communities from Bohemian Forest, Czech Republic ? CSE3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019487White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaGEnvironmentalOpen in IMG/M
3300021967Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - AB:C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022498Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022501Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022511Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022717Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300023313Hydrothermal Fe-rich mat microbial community from Urashima Vent Field, Mariana Arc, Pacific Ocean - 801-BM1-B4EnvironmentalOpen in IMG/M
3300024220Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5EnvironmentalOpen in IMG/M
3300030525Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO037SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030531Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO038SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030533Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030539Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO151-VCO111SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030551Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030565Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030569Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb5 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030573Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO143-VCO036SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030575Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO747-VDE050SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030585Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Cnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030591Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bb3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030594Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO089SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030628Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030632Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO132-ANR004SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030776Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030777Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030779Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB1 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030790Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_OS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030841Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030845Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030847Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030848Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030852Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030854Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB2 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030855Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030923Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030974Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA8 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030996Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031015Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031868Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032273Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxicEnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
TDF_OR_ARG04_113mDRAFT_100133243300000121MarineVTPDARRTAVFRSGTAKGXIGIIPVGGQQHPSSGVGARLLWKKAQKNPKKNKTSEAMNKIIPHRIPLVTYEV*
TDF_MC_ARG01_113mDRAFT_100060013300000125MarineVTPDAKRTAVLRRGTENGFSGLIPVGGQEQPNSGVGARLLWKNAQKKAKKNIISEVINRIIPQRSPLVT*
TDF_OR_ARG05_123mDRAFT_103366633300000242MarineMVSSGSVTPEARSTAVFKRGTEKGFKGSIPVGGQEQPSSGVGARLLWKNAQKKAKKNITSDVINRIIPHRNPLIT*
WSSedA2C3DRAFT_1000088113300000917WetlandTVMDKAWMALVRLPSISLWWAHVTVTPEASRTAVFSSGTLNGFRGVIPMGGQQQPSSGVGASLL*KNAQKKAAKKHTSDRMKSIIPYRRPLDT*
JGI20216J20342_100317613300001806WetlandMDKAWMALVRLPSISLWWAHVTVTPEASRTAVFSSGTLNGFRGVIPMGGQQQPSSGVGASLL*KNAQKKAAKKHTSDRMKSIIPYRRPLDT*
Ga0005456J37224_10734813300002662Forest SoilVFDRFISISLWCAQVTVTPDARRTAVLSSGTLNGLRGLIPVGGQQHPSSGVGASLLWKNAQKNAKKNRTSDVINRIIPHRKPFVT*
Ga0005482J37270_10747223300002668Forest SoilMRLWWAHVTVTPDARRTAVFKSGTLNGLSGLIPVGGHAHPSSGVGASLLWKKAQKKAKKNRISDVMNKIIPQRRPFVTAEVW*
Ga0051092_100052593300003151Alvinella Pompejana EpibiontMIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDNLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*
Ga0007425J51702_10036313300003550Avena Fatua RhizosphereMSQVTVTPEANNTAVFSNGTLNGFNGVIPVGGQAHPSSGVGDIFYEKKAQKNAKKNNTSEVINRIIPHRSPFVTYVVWCPRYVASRITSR
Ga0058896_137301913300004101Forest SoilVFVRLLAKIL*CAHVTVTPEANNTAVFSNGTLNGFNGVIPVGGQQHPSSGVGDKLLWKNAQKNAKKKSTS
Ga0058891_100173713300004104Forest SoilMVKYTPRAMVSTSA*IVFDRFISISLWCAQVTVTPDARRTAVLSSGTLNGLRGLIPVGGQQHPSSGVGASLLWKNAQKNAKKNRTSDVINRIIPHRKPFVT*
Ga0058884_126139413300004135Forest SoilVKYAPSRTVTIKA*IVLSRLFSINL**AQVTVTPEANSVAVFSNGILNGFNGITPAGGHAQPISGVGDKLLWKNAQKNAKKNSTSDVMNRIMPQRSPVVTYEV*CPIKVASR
Ga0066239_100599113300004340Mangrove SedimentMAFERSPSIRLWWAHVTVTPEASRTAVFRRGTLNGLIGVIPTGGQQHPSSGVGARLLWKKAQKKAKKKHTSEIIKRTIPHRKPLATYEV*
Ga0068963_143639523300004618Peatlands SoilVTPEARRTAVFSRGTLNGFSGLMPTGGQQQPSSGVGERLLWKKAQKKAKKKRTSDVMNKIIPHRSPVVTYEVW
Ga0072504_101697243300005095MarineMIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDSLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*
Ga0075487_102451313300006356AqueousMAHVTVTPDANNTAVLSKGTAKGLRTEIPVGGHVHPSSGVGARDLWKNAQKNAKKKQTSEIINKIIPHRSPFVTTDVWWPR*
Ga0075183_1135360123300007232Wastewater EffluentVLVRVPSINLWCAHVTVTPEARRTAVLSNGILNGFSVVIPTGGQVQPSSGVGASLLWKNAQKNAKKKHTSDKINSNIPYRSPVVTYEL*
Ga0075022_149336613300007526WatershedsMRACIVLDRFFSRSLWWAQVTVTPDASRTAVFRRGTLNGFRGLIPTGGQQHPSSGVGERLLWKNAQKKAKKNRTSEVINRIIPHRSPVVT*
Ga0099808_106539033300008035CoralVTDTPEASKTAVFSKGTEKGLMGSIPVGGQVHPSSGVGASDLWKKAQKKAKKNITSEVINRIIPHRSPLVT*
Ga0099805_155417913300008038CoralVTPEAKSTAVLRSGIAKGFRGSIPGGGQEHEICGVGASLLWKNPQKNAKKNITSETINRIIPSFSPERTKEEWCP*
Ga0100406_156224913300008042CoralVLGRSCSIRAWWAQVTVTPDARRTAVLSKGTLNALIGVIPVGGQEQPSSAVGANLLWKKDQKKAKKKQTSEIINRIIPHRSPKVTL*
Ga0103951_1025578813300008832MarineMASVRLLARILWCAHVIVTPDDNRTAVFSSGTRNGFRGVIPVGGQVTPISTVGARLLWKNAQKKAKKKQTSEVINKIMP*
Ga0103951_1069364413300008832MarineVTPEARRTAVFRRGIENGLRGEIPVGGHLHPSSGVGARLLWKKDQKKAKKNRTSEAIKRIIPHRSPLATFKV*
Ga0103502_1015278613300008998MarineMASVRFLARILWCAHVIVTPDDNRTAVFSSGTRNGFRGVIPVGGQVTPISTVGARLLWKNAQKKAKKKQTSEVINKIMP*
Ga0115591_105001913300009586WetlandMVRDWMAFDRSPSINLWWAQVTVTPDASRTAVLRRGTLKGFKGLIPIGGQQHPISGVGDRLLWKNAQKNAKKKHTSDKMNRIIPRRRPLVTYVV*
Ga0123358_1454413300009721MarineMRAWWANVTVTPEANKTPVFNSGIEKGLIGSIPAGGQVQPISGVGANLLWKNAQKNAKKKQTSERINKTIPIRMPLTTAELWNP*
Ga0123359_16017013300009730MarineVIVTPDARRTAVFRRGTEKGLIGTIPVGGQVQPSSGVGANLLWKKAQKKAKKNKTSEAINKIIPHRSPFKTYSV*
Ga0123367_111731133300009757MarineVKNSPNRTVIVRAWIVSGLFCSSSLWWAQVTVTPDARSTAVFRSGTENGLIGVTPVGGQAHPNSWVGASLLWKNAQKNAKKKRISETINRIIPIRSPLVT*
Ga0126339_10001545133300010033CoralMVIKSLKDALKCCRSNNLWCAQVTDTPEASKTAVFSKGTEKGLMGSIPVGGQVHPSSGVGASDLWKKAQKKAKKNITSEVINRIIPHRSPLVT*
Ga0115595_104915713300010138WetlandVTVTPDASSTAVFNKGTLKGLIGVIPTGGQQQPSSGVGAKLLWKNAQKNAKKKHTSDRMNRIMPHRRPLAT*
Ga0126360_103942813300010854Boreal Forest SoilVLVRFCSISLWCAHVTVTPDASSVAVLSRGTLNGFNGLIPVGGQAHPNSGVGARLLWKNAQKNAKKNSTSDVINRIIPHRNPFVT*
Ga0137371_1000237753300012356Vadose Zone SoilLARFCSKSLWWAHVTVTPDARRTAVLRRGTLNGFNGVIPVGGHAHPSSGVGDSLLWKKAQKNAKKNKISDVINKIIPQRRPFVT*
Ga0193221_100832013300018585MarineMDSVRFPSIKLWCAHVTVTPEARRTAVFKRGTEKGLIGSIPVGGQAHPNSGVGANLLWKKAQKNAKKNKTSDAINKIIPHRRPFTTDDV
Ga0193142_102810813300018641MarineMASVRFLARILWWAHVIVTPDDNRTAVFSSGTRNGFRGVIPVGGQVTPISTVGARLLWKNAQKKAKKKQTSEVINKIMP
Ga0193122_106094823300018661MarineMVTPDARSTAVLSSGTEKGLRGWIPVGGQAHPSSGVGASLLWKNAQKNAKKNITSEVINKIIPQRNPEITYVVCSPI
Ga0193038_100951623300018723MarineVTVTPEAKRTAVLRRGIAKGFKAEIPVGGHVHPNSMVGASLLWKKAQKKAKKNKISETINRIIPHRNPPTTLEVWKPI
Ga0193038_106778013300018723MarineVRPAIASGRFPSMSAWWAHVTDTPEAKRTAVLRRGTANGFSGVIPVGGQQQPSSGVGARLLWKNAQKKAKKNSTSDVIKSAIPQ
Ga0193147_103760013300018747MarineMASVRFLARILWCAHVIVTPDDNRTAVFSSGTRNGFRGVIPVGGQVTPISTVGARLLWKNAQKKAKKKQTSEVINKIMP
Ga0193226_105756323300018835MarineVTVTPDARSTPVFKSGTEKGLITWIAVGGQVQPISGVGASLLWKKAQKKAKKNRTSETINRIIPSRRLFIINSV
Ga0193226_105827913300018835MarineMASVRLLARILWCDHVIVTPEERSTAVFSSGTRKGFSGVIPVGGQVTPISTVGARLLWKNAQKNAKKKQTSDVMNRIIPYRSPFSTTAVCHP
Ga0193552_1010927113300018934MarineMLWCAHVTVTPEDSKTAVFRSGTRNGFIGLIPVGGQHTPSSIVGASLLWKKAQKKAKKKHTSDVMNNIMPYRSPLLTIRVWYPWNV
Ga0193552_1013402713300018934MarineVTVTPEARRTAVLSKGTAKGLSGAIPVGGQVQPISGVGANLLWKKAQKNAKKNITSEEMNRIIPHRSPLTT
Ga0193552_1015822613300018934MarineMASSRFFDKILWWAHVTVTPEESKTAVLRRGTRKGLIGFMPVGGQQTPNSIVGANLLWKNAQKKAKKKQTSEVIKRIIPPC
Ga0193128_1011126613300018951MarineVVLIKFPSINLWCAQVTVTPEARRTAVFKRGTAKGLSTEIPVGGQVHPISGVGAKELWKKAQKKAKKNNTSEVINKIIPHRSPLIT
Ga0193560_1015792313300018958MarineMASARLAAKRLWWAHVTVTPLARRTAVLRSGTWKGFIGSMPVGGQHAPSSTVGARLLWKNAQKKAKKNNTSEVIKRIIPSRRPTPTGIVWHPW
Ga0193332_1019659313300018963MarineMDSVRFPARILWWAHVIVTPEDRRTAVFRRGTRNGFRGVIPVGGQVTPISTDGASLLWKNAQKKAKKKHTSEVMKRIIPYRSPFSTIAVCLP
Ga0193559_1013808913300018971MarineVTVTPEASKTAVFNRGTAKGLMGVIPVGGHVHPSSGVGARLLWKKAQKKAKKKSTSEAMNKIMPHRMPLVT
Ga0193123_1020169213300019039MarineMVTPDARSTAVLRSGTENGLRGWIPVGGQAHPNSGVGANLLWKNAQKNAKKNITSEVINRIIPQRNPEITYVVCSPI
Ga0193123_1027072413300019039MarineVTPEARRTAVLRRGIEKGLIGEIPVGGQLQPSSGVGASLAWKNDQKKAKKKRTSEAINKIIPQRKPLATFNV
Ga0193189_1011656123300019044MarineMLWCAHVTVTPEDSKTAVFRSGTRNGFIGLIPVGGQHTPSSIVGASLLWKKAQKKAKKKHTSEVMNNIMPYRSPLLTIR
Ga0184588_12473213300019186SoilMVFVRFISISLXXAHVTVTPDASKTAVFNSGILNGFKGLIPVGGQQHPSSGVGDNLLXKNAQKNAKKNKTSDVINRIIPHRNPVVTCDVXCPIKV
Ga0180114_116066533300019232Groundwater SedimentVKYAPRATVRINAWMVLVRLFSSNLWWAHVTVTPEANRTAVFSKGTLNGLRGVMPAGGQQHPNSGVGDKLLWKNAQKNAKKNSTSEVINRIIPHRNPLVT
Ga0187893_1007370293300019487Microbial Mat On RocksVKYAPSMTVRISPWMQFVRLCSRRLWWAQVTVTPEANKVAVLRSGTLYGFSGFTPIGGHIHPISGVGDKLLWKKAQKNAKKNRTSEVMNRIIP
Ga0213848_123071413300021967WatershedsVLDRLPSINLWCAHVTVTPDAKSTAVFSKGTLNGSSVVIPAGGQQQPNSGVGASLLWKNAQKNAKKKHTSDTINRSIPYRN
Ga0242644_101403513300022498SoilMRLWWAHVTVTPDARRTAVFKSGTLNGLSGLIPVGGHAHPSSGVGASLLWKKAQKKAKKNRISDVMNKIIPQRRPFVTAEVW
Ga0242645_101910113300022501SoilVFDRFISISLWCAQVTVTPDARRTAVLSSGTLNGLRGLIPVGGQQHPSSGVGASLLWKNAQKNAKKNRTSDVINRIIPHRKPFVT
Ga0242651_101405223300022511SoilMRLWWAHVTVTPDARRTAVFKSGTLNGLSGLIPVGGHAHPSSGVGASLLWKKAQKKAKKNRTSDVMNKIIPQRRPFVTAEVW
Ga0242651_101631213300022511SoilVFFRFISRSLWWAQVTVTPEARSTAVFSSGTLNGFRGLIPVGGQAHPSSGVGANLLWKNAQKNAKKNNTSDVMNKIIPHRSPFVT
Ga0242663_108353213300022523SoilVFFRLFSMRLWWAHVTVTPDARRTAVFKSGTLNGLSGLIPVGGHAHPSSGVGASLLWKKAQKKAKKNRISDVMNKIIPQRRPFVTAEVW
Ga0242653_107402913300022712SoilVFDRFISISLWCAQVTVTPDARRTAVLSSGTLNGLRGLIPVGGQQHPSSGVGASLLWKNAQKNAKKNRTSDVINIIIPHRKPFVT
Ga0242661_105708523300022717SoilMRLWWAHVTVTPDARRTAVFKSGILNGLSGLIPVGGHAHPSSGVGASLLWKKAQKKAKKNRISDVMNKIIPQRRPFVTAEVW
Ga0256748_100297433300023313Hydrothermal Fe-Rich MatMVTPDARSTAVFRRGTANGLRGWMPVGGQEHPSSGVGARLLWKKAQKKARKNITSDTINRIIPHRRPEMT
Ga0224568_100375223300024220Plant LitterLCSSNLXCAQVTVTPEASNVAVFNNGILNGFNGLIPVGGQAQPISGVGDNLLWKNAQKNAKKNNTSDVINKIIPQRKPVVT
Ga0210273_130220913300030525SoilLVRFISIKLWXAHVTVTPDANRTAVFSNGILNGFNGLIPVGGQQQPNSGVGERLLXKNAQKNAKKNRTSDVINKIIPQRNPVVT
Ga0210274_146684313300030531SoilMRLFSRSLXCAHVTVTPDASNVAVFNSGMLNGFRGVIPVGGQAHPISGVGDKLLWKNAQKKAKKNNTSEVINKIIPQRKPVVTYEVXCPIKVASRITSR
Ga0247632_100542913300030533SoilVIVTPDARRTAVFKRGTLNGFRGVMPVGGHEHPSSGVGDRLLWKYAQKKAKKNRTSDVINRIIPHRSPFVTYVVW
Ga0210281_115848923300030539SoilVTPDASKTAVLRRGTLKGLRGYTPDGGQQQPSSGVGDRLLWKNAQKKAKKNRTSDVINKIIPHRRPVVTYEV
Ga0247638_105882223300030551SoilMPRTTVTVSAXIVFIRFFSRRLXXAHVTVTPDANRVAVFNKGTLNGLSGVIPAGGQQQPNSGVGDNLLWKKAQKNAKKNNTSDVINRIIPQRNPFVT
Ga0210256_1079779923300030564SoilLVRFISIKLWXAHVTVTPDANRTAVFSNGILNGFNGLIPVGGQQQPNSGVGERLLXKNAQKNAKKKNRTSDVINKIIPQRNPVVT
Ga0247635_108814023300030565SoilVTVTPEASSVAVLRSGTLKGFNGLIPVGGQAQPISGVGDSLLWKNAQKKAKKNKTSEVINKIIPQRSPLVTIEV
Ga0247628_101258023300030569SoilVTVTPDASNTAVFSRGTLNGFRGVIPDGGHIQPSSGVGDKLLWKNAQKNAKKNNTSDVIKRIIPQRSPLVT
Ga0210272_101262313300030573SoilVFARLFSNSLXCAQVTVTPDASRVAVFSSGTLKGFNGLIPAGGQAHPISGVGDSLLWKNAQKNAKKNNTSEVINRIMP
Ga0210288_103925423300030575SoilLVRFISIKLWXAHVTVTPDANRTAVFSNGILNGFNGLIPVGGQQQPNSGVGERLLXKNAQKNAKKNSTSDVINKIIPQRNPVVT
Ga0247639_123297213300030585SoilVTVTPEASSVAVLRSGTLKGFNGLIPVGGQAQPISGVGDSLLWKNAQKKAKKNKTSEVINKIIPQRNPFITYVV
Ga0247626_115050913300030591SoilVIVTPDARRTAVFKRGTLNGFRGVMPVGGHEHPSSGVGDRLLWKYAQKKAKKNRTSDVINGIIPHRSPFVTYVVW
Ga0210280_102172123300030594SoilMRLFSISLWWAHVTVTPDARSTAVFNSGTLNGFRGLIPTGGQQQPSSGVGDSLLWKNAQKKAKKNRTSDVINKIIPHRSPVVT
Ga0247629_1035174213300030628SoilVIVTPDARRTAVFKRGKLNGFRGVMPVGGHDHPSSGVGDRLLWKYAQKKAKKNRTSDVINRIIPHRIPFVTYVVW
Ga0210250_1041451613300030632SoilVLVRFISIKLWXAHVTVTPDANRTAVFSNGILNGFNGLIPVGGQQQPNSGVGERLLXKNAQKNAKKNRTSDVINKIIPQRNPVVT
Ga0075396_105547513300030776SoilVFFRLFSSRLWWAQVTVTPEASNVAVFNNGTLNGFNGLIPVGGQAHPISGVGDSLLWKNAQKNAKKNNTSDVINKIIPQRSPFIT
Ga0075402_1230506323300030777SoilVFFRLFSSRLWWAQVTVTPEASNVAVFNSGTLNGFSGLIPVGGQAHPISGVGERLLWKNAQKNAKKNNTSDVINKIIPQRSPFIT
Ga0075402_1233812113300030777SoilVLARFCSRSLWCAHVTVTPDARSTAVFSNGTLNGFRGVIPVGGQAHPSSGVGDKLLWKNAQKNAKKNSTSDVINRIIPHRRPFVTYVV
Ga0075378_1002348613300030779SoilVFVRLFSINLWWAHVTVTPDARRTAVFRRGTLNGFSGLIPAGGQQHPSSGVGDRLLWKKAQKNAKKNSTSDVINRIIPHRSPVVTYEV
Ga0138304_101971113300030790SoilVFIRLFSKSLWWAQVTVTPDANNVAVLSKGTLKGLSGLIPVGGQAQPISGVGDKLLWKNAQKNAKKNSTSEVINRIIPQRNPVIT
Ga0075384_1113990013300030841SoilMVFLRLFSNNLWWAHVTVTPEANSTAVFNKGTLNGFNGVIPEGGQQQPSSGVGDSLLWKKAQKKAKKKSTSEVINKIIPHRKPFVT
Ga0075397_1045553313300030845SoilVFDRLFSRSLWWAQVTVTPDARSTAVFSNGTLNGLRGVIPTGGQQHPNSGVGDNLLWKNAQKNAKKNNTS
Ga0075405_1000967813300030847SoilVFFRLFSSRLWWAQVTVTPEASNVAVFNNGTLNGFNGLIPVGGQAHPISGVGDNLLWKNAQKNAKKNNTSDVINKIIPQRSPFIT
Ga0075405_1003664513300030847SoilVLARFCSRSLWCAHVTVTPDARSTAVFSNGTLNGFRGVMPVGGQAHPSSGVGDRLLWKNAQKNAKKNSTSDVINRIIPHRRPFVTYVV
Ga0075388_1006914913300030848SoilVLELYLFVFFSSNLWCAQVTVTPEANNVAVLSKGTLNGLSGLIPVGGHAQPISGVGDSLLWKNAQKNAKKNNTSEVINRIIPQRNPVIT
Ga0075389_1005813713300030852SoilVFDRLFSRSLWWAQVTVTPDARSTAVFSNGTLNGLRGVIPTGGQQHPNSGVGDNLLWKNAQKNAKKNNTSDVINRIMPHRRPDVT
Ga0075385_1003952313300030854SoilVFVRLFSINLWWAHVTVTPDARRTAVFRRGTLNGFSGLIPAGGQQHPSSGVGDRLLWKKAQKNAKKNSTSDVINRIIPHRSPVVTYEFQRSE
Ga0075374_1116924013300030855SoilVFVRLFSINLWWAHVTVTPDARRTAVFRRGTLNGFSGLIPAGGQQHPSSGVGDRLLWKKAQKNAKKNSTSDV
Ga0138296_164045013300030923SoilVTPDASNTAVFSRGTLNGLRGVIPVGGHAHPSSGVGESLLWKNAQKKAKKNKTSDVMNRIIPQRRPFVTCVVWC
Ga0138303_124954513300030939SoilVRSRAWIVLVRLCSRSLWWAHVTVTPDAKRTAVFRRGTLNGLRGVIPVGGHAQPNSGVGDRLLWKNAQKNAKKNRTSEVINRIIPQRNPLVT
Ga0075371_1009358613300030974SoilFSSRLWWAQVTVTPEASNVAVFNSGTLNGFSGLIPVGGQAHPISGVGERLLWKNAQKNAKKNNTSDVINKIIPQRSPFIT
Ga0075371_1081101813300030974SoilVRLFSINLWWAHVTVTPDARRTAVFRRGTLNGFSGLIPAGGQQHPSSGVGDRLLWKKAQKNAKKNSTSDVINRIIPHRSPVVTYEV
Ga0074004_1085201513300030996SoilVFNRLFSSSLWCAQVTVTPEARRTAVFNNGTLNGFNGVIPAGGQQQPNSGVGDNLLWKNAQKNAKKNNTSDVMNKIIP
Ga0138298_160433913300031015SoilVFIRLCSKRLWWAQVTVIPDASRTAVFNNGTLNGLRGVIPVGGQAQPSSGVGDSLLWKNAQKNAKKNSTSEVINRIIPHRRPFVT
Ga0138298_169185113300031015SoilVRLCSRSLWWAHVTVTPDAKRTAVFRRGTLNGLRGVIPVGGHAQPNSGVGDNLLWKNAQKNAKKNRTSEVINRIIPQRNPLVT
Ga0308023_110154813300031167MarineVCLPSINLWWAQVTVTPEARSTAVFNNGIAKGFKTEIPVGGQAHPNSVVGDRELWKKAQKKAKKKAISEAINKIIPQRSPLVTWDV
Ga0170824_10804433913300031231Forest SoilVTPEARRTAVLSKGTLNGFKGVIPVGGQQHPNSGVGDNLLWKNAQKKAKKNNTSDVINKIIPHRKPLVTYEVW
Ga0170824_12567483713300031231Forest SoilVKYAPNATVIINAWIVFTRLFSRSLWWAQVTVTPEASSVAVFRSGTLNGFNGLIPVGGQAQPISGVGDRLLWKNAQKNAKKNNTSEVMNKIIPQRSPVITYDVW
Ga0170820_1176835713300031446Forest SoilVLELYLFVFFSKSLXWAQVTVTPDANKVAVLSKGTLNGLSGLMPVGGHAQPISGVGDRLLXKNAQKNAKKNNTSEVINRIIPQRNPVMT
Ga0170819_1252581713300031469Forest SoilMLELYFLGFFSSSLWWAQVTVTPEASSVAVFSSGTLNGFNGLIPVGGQAHPISGVGDKLLWKNAQKNAKKNSTSEVMNKIIPHRSPVITYVVW
Ga0308014_101402843300031628MarineILXCAQVMVTPDESRTAVFRSGTRNGLRGDIPAGGQVTPISMDGANLLXKKAQKKAKKKHTSEVINKIIP
Ga0316038_11431923300031868SoilMVFVRFISISLXXAHVTVTPDASKTAVFNSGILNGFKGLIPVGGQQHPSSGVGDNLLXKNAQKNAKKNKTSDVINRIIPHRNPVVTCDVXCPIKVLSRI
Ga0316197_1026135113300032273SedimentVTVAPDPRRTAVFRRGTLKALIGVIAVGGQVHPSSGVGARALWKNAQKNEKKKHTSDRINRIIPNRRQESNSLV
Ga0314685_1043334513300032651SeawaterLAASKLWWAHVTVTPEAKSTAVLRRGTWNGFIGSIPVGGQHEPSSMVGAKLLWKKAQKKAKKKSTSEVINKIIPSRNPIFTGTVWHP
Ga0314678_1000969323300032666SeawaterMLWCAHVIVTPEDKRTAVFSSGTRNGFRGVIPVGGQVAPISTVGARLLWKNAQKKAKKKQTSEVINKIMP
Ga0335070_1199219823300032829SoilFLLFPSISLWWAHVTVTPDASSTAVFSRGTLNALMGLIPTGGQQHPSSVVGASLLWKKAQKNAKKKHTSERINRSIPYRSPLATYVV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.