3300003151: Alvinella pompejana epibiont microbial communities from the East Pacific Rise hydrothermal vent

Overview

Basic Information

• IMG/M Taxon OID: 3300003151
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0055713 | Gp0052075 | Ga0051092
• Sample Name: Alvinella pompejana epibiont microbial communities from the East Pacific Rise hydrothermal vent
• Sequencing Status: Finished
• Sequencing Center: SymBio Corporation
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 147567453
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Alvinella Pompejana Epibiont Microbial Communities From The East Pacific Rise Hydrothermal Vent
• Type: Host-Associated
• Taxonomy: Host-Associated → Annelida → Integument → Cuticle → Epibionts → Alvinella Pompejana Epibiont → Alvinella Pompejana Epibiont Microbial Communities From The East Pacific Rise Hydrothermal Vent

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Host-associated → Animal → Animal surface

Location Information

• Location: East Pacific Rise
• Coordinates
  • Lat. (^o): 9.8344
  • Long. (^o): -104.2844
  • Alt. (m): N/A
  • Depth (m): 2500

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088984	Metagenome / Metatranscriptome	109	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0051092_1000525	All Organisms → cellular organisms → Eukaryota → Opisthokonta	4484

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0051092_1000525	Ga0051092_10005259	F088984	MIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDNLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*