3300005095: Hydrothermal chimney microbial communities from the East Pacific Rise - L vent 8

Overview

Basic Information

• IMG/M Taxon OID: 3300005095
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0114640 | Gp0114745 | Ga0072504
• Sample Name: Hydrothermal chimney microbial communities from the East Pacific Rise - L vent 8
• Sequencing Status: Permanent Draft
• Sequencing Center: Beijing Genomics Institute (BGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 420551688
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hydrothermal Chimney In Epr
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Hydrothermal Chimney In Epr

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent chimney → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: East Pacific Rise
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088984	Metagenome / Metatranscriptome	109	Y
F103293	Metagenome	101	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0072504_101697	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria	16068
Ga0072504_129017	Not Available	15845

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0072504_101697	Ga0072504_10169724	F088984	MIAFFRSPSISLWWAHVTDTPDARRTAVFRRGTANGSRGVIPGGGQLQPISGVGDSLLWKNAQKILMKNITSEAMKKIIPQRSPWATTEV*
Ga0072504_129017	Ga0072504_12901725	F103293	MIEIEKLPELPPPYEIYEFQPCQPAYFKVVEFKIGRMTIQPRFPGAPPTKTIAAIRLYVDPKTKKFYPPWYDITPSRLVYQLAGMLTQGIPQGMWLRIHRDVPGPKAHFSVSWVQAPP*