| Basic Information | |
|---|---|
| Family ID | F082105 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 113 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MAAPLMHEPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 113 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 22.12 % |
| % of genes from short scaffolds (< 2000 bps) | 89.38 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.13 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.460 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands (19.469 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.743 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (43.363 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.13 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 113 Family Scaffolds |
|---|---|---|
| PF00665 | rve | 10.62 |
| PF01695 | IstB_IS21 | 2.65 |
| PF02899 | Phage_int_SAM_1 | 1.77 |
| PF05280 | FlhC | 0.88 |
| PF00072 | Response_reg | 0.88 |
| PF13565 | HTH_32 | 0.88 |
| PF01609 | DDE_Tnp_1 | 0.88 |
| PF13384 | HTH_23 | 0.88 |
| PF00078 | RVT_1 | 0.88 |
| PF12161 | HsdM_N | 0.88 |
| PF13683 | rve_3 | 0.88 |
| COG ID | Name | Functional Category | % Frequency in 113 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 10.62 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 10.62 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 10.62 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 10.62 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 2.65 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.77 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.77 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.88 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.88 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.88 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.88 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.88 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.46 % |
| Unclassified | root | N/A | 3.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000121|TDF_OR_ARG04_113mDRAFT_c1036339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300000122|TDF_OR_ARG04_123mDRAFT_c1000202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 4600 | Open in IMG/M |
| 3300000130|SA_S2_NOR15_50mDRAFT_c10075557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1290 | Open in IMG/M |
| 3300000241|BS_KBA_SWE21_205mDRAFT_10090556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 665 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1021326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1535 | Open in IMG/M |
| 3300001750|JGI24023J19991_10152385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 655 | Open in IMG/M |
| 3300002495|BRMGV_1033187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1124 | Open in IMG/M |
| 3300002988|FeGlu_10137760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3308 | Open in IMG/M |
| 3300004005|Ga0055448_10101626 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1081 | Open in IMG/M |
| 3300004022|Ga0055432_10025025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1280 | Open in IMG/M |
| 3300004058|Ga0055498_10014452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1089 | Open in IMG/M |
| 3300004070|Ga0055488_10132837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300005590|Ga0070727_10280351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 929 | Open in IMG/M |
| 3300005600|Ga0070726_10292509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300005612|Ga0070723_10256042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 814 | Open in IMG/M |
| 3300005821|Ga0078746_1030544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1131 | Open in IMG/M |
| 3300005832|Ga0074469_10674332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1296 | Open in IMG/M |
| 3300005836|Ga0074470_10207367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales | 1660 | Open in IMG/M |
| 3300008465|Ga0115360_10002174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 2236 | Open in IMG/M |
| 3300009035|Ga0102958_1180090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 697 | Open in IMG/M |
| 3300009515|Ga0129286_10312847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300009702|Ga0114931_10057415 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3726 | Open in IMG/M |
| 3300010392|Ga0118731_109110813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2143 | Open in IMG/M |
| 3300010392|Ga0118731_110097853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300010392|Ga0118731_112671057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1107 | Open in IMG/M |
| 3300010392|Ga0118731_114236286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1518 | Open in IMG/M |
| 3300010430|Ga0118733_102651900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 989 | Open in IMG/M |
| 3300010430|Ga0118733_103778935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300010969|Ga0139246_1096775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1224 | Open in IMG/M |
| 3300010997|Ga0139324_1147841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 632 | Open in IMG/M |
| 3300011262|Ga0151668_1060573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300014260|Ga0075307_1036421 | Not Available | 908 | Open in IMG/M |
| 3300014264|Ga0075308_1013837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1412 | Open in IMG/M |
| 3300014264|Ga0075308_1026093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1063 | Open in IMG/M |
| 3300014295|Ga0075305_1030256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 944 | Open in IMG/M |
| 3300014295|Ga0075305_1082741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300014296|Ga0075344_1049219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300014296|Ga0075344_1059097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 708 | Open in IMG/M |
| 3300014297|Ga0075306_1060254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 664 | Open in IMG/M |
| 3300014299|Ga0075303_1046194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300014874|Ga0180084_1069030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 720 | Open in IMG/M |
| 3300019696|Ga0194017_1001961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1545 | Open in IMG/M |
| 3300019713|Ga0193987_1009664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_30 | 943 | Open in IMG/M |
| 3300019714|Ga0193975_1027037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300019718|Ga0193999_1007348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1047 | Open in IMG/M |
| 3300019732|Ga0194014_1000506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3350 | Open in IMG/M |
| 3300019738|Ga0193994_1040611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300019739|Ga0194012_1032994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 658 | Open in IMG/M |
| 3300022206|Ga0224499_10205314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 671 | Open in IMG/M |
| 3300022306|Ga0224509_10284442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 600 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10018358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1795 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10227405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 636 | Open in IMG/M |
| (restricted) 3300024057|Ga0255051_10147622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 836 | Open in IMG/M |
| 3300025521|Ga0210083_1019083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 952 | Open in IMG/M |
| 3300025550|Ga0210098_1040226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 744 | Open in IMG/M |
| 3300025551|Ga0210131_1046254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300025558|Ga0210139_1083654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 653 | Open in IMG/M |
| 3300025560|Ga0210108_1053224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 777 | Open in IMG/M |
| 3300025563|Ga0210112_1099455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300025565|Ga0210110_1002676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5125 | Open in IMG/M |
| 3300025565|Ga0210110_1033677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1284 | Open in IMG/M |
| 3300025565|Ga0210110_1058548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 935 | Open in IMG/M |
| 3300025797|Ga0210062_1024043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1522 | Open in IMG/M |
| 3300025801|Ga0210097_1018877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1517 | Open in IMG/M |
| 3300025801|Ga0210097_1026927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1281 | Open in IMG/M |
| 3300025813|Ga0210064_1001992 | Not Available | 7989 | Open in IMG/M |
| 3300025823|Ga0210123_1033855 | Not Available | 1753 | Open in IMG/M |
| 3300025883|Ga0209456_10222174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 800 | Open in IMG/M |
| 3300025895|Ga0209567_10415346 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 648 | Open in IMG/M |
| 3300025895|Ga0209567_10469701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 609 | Open in IMG/M |
| 3300025947|Ga0210067_1007932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1300 | Open in IMG/M |
| 3300025954|Ga0210135_1025499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 619 | Open in IMG/M |
| 3300025977|Ga0210072_1048323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 569 | Open in IMG/M |
| 3300026007|Ga0210124_1142939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 761 | Open in IMG/M |
| 3300026012|Ga0208653_1005146 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1094 | Open in IMG/M |
| 3300027612|Ga0209037_1119630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 640 | Open in IMG/M |
| 3300027790|Ga0209273_10313951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 635 | Open in IMG/M |
| 3300027822|Ga0209633_10446327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 594 | Open in IMG/M |
| (restricted) 3300027865|Ga0255052_10170684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1062 | Open in IMG/M |
| (restricted) 3300027881|Ga0255055_10243473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 976 | Open in IMG/M |
| 3300028598|Ga0265306_10190053 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
| 3300028598|Ga0265306_10206045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1043 | Open in IMG/M |
| 3300028598|Ga0265306_10416515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300028598|Ga0265306_10587175 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 613 | Open in IMG/M |
| 3300028598|Ga0265306_10625321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 594 | Open in IMG/M |
| 3300028599|Ga0265309_10665628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 704 | Open in IMG/M |
| 3300028600|Ga0265303_10795565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300031371|Ga0307423_1081403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1001 | Open in IMG/M |
| 3300031539|Ga0307380_10108034 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2851 | Open in IMG/M |
| 3300031553|Ga0315547_1052725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1541 | Open in IMG/M |
| 3300031565|Ga0307379_10077810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3674 | Open in IMG/M |
| 3300031665|Ga0316575_10102314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1165 | Open in IMG/M |
| 3300031727|Ga0316576_10435724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 969 | Open in IMG/M |
| 3300031728|Ga0316578_10387330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 829 | Open in IMG/M |
| 3300032061|Ga0315540_10218236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300032136|Ga0316201_10940648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 728 | Open in IMG/M |
| 3300032168|Ga0316593_10162210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 817 | Open in IMG/M |
| 3300032231|Ga0316187_10028793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales | 4541 | Open in IMG/M |
| 3300032231|Ga0316187_10448868 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 970 | Open in IMG/M |
| 3300032231|Ga0316187_10476015 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 938 | Open in IMG/M |
| 3300032231|Ga0316187_10667563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300032251|Ga0316198_10540543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 636 | Open in IMG/M |
| 3300032252|Ga0316196_10385423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 601 | Open in IMG/M |
| 3300032258|Ga0316191_10644356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 769 | Open in IMG/M |
| 3300032259|Ga0316190_10226893 | Not Available | 1290 | Open in IMG/M |
| 3300032259|Ga0316190_10629520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300032259|Ga0316190_10793590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 625 | Open in IMG/M |
| 3300032260|Ga0316192_10442357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 887 | Open in IMG/M |
| 3300032260|Ga0316192_10452317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 876 | Open in IMG/M |
| 3300032260|Ga0316192_10746040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 659 | Open in IMG/M |
| 3300032262|Ga0316194_10632986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 673 | Open in IMG/M |
| 3300032272|Ga0316189_10121149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → Sedimenticola → Sedimenticola selenatireducens | 2113 | Open in IMG/M |
| 3300032273|Ga0316197_10463403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 677 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 19.47% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 11.50% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 8.85% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 6.19% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 6.19% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 6.19% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.42% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 3.54% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 3.54% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 3.54% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 2.65% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.65% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.77% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.77% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 1.77% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.77% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.77% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.89% |
| Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Oil-Contaminated Sediment → Mangrove Soil | 0.89% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.89% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.89% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.89% |
| Marine | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine | 0.89% |
| Hydrothermal Chimney Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat | 0.89% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.89% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.89% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.89% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.89% |
| Wetland Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment | 0.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.89% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000122 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 04_12.3m | Environmental | Open in IMG/M |
| 3300000130 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50m | Environmental | Open in IMG/M |
| 3300000241 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5m | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300001750 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 | Environmental | Open in IMG/M |
| 3300002495 | 454 Fosmid Sequence | Environmental | Open in IMG/M |
| 3300002988 | Fe-reducing enrichment culture from wetland sample 1 | Environmental | Open in IMG/M |
| 3300004005 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005821 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, PM1 | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300008465 | Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC5B | Environmental | Open in IMG/M |
| 3300009035 | Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG | Environmental | Open in IMG/M |
| 3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
| 3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010969 | Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.out | Environmental | Open in IMG/M |
| 3300010997 | ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
| 3300011262 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total | Environmental | Open in IMG/M |
| 3300014260 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
| 3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014296 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300014297 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
| 3300019696 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_3-4_MG | Environmental | Open in IMG/M |
| 3300019713 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_3-4_MG | Environmental | Open in IMG/M |
| 3300019714 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_2-3_MG | Environmental | Open in IMG/M |
| 3300019718 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MG | Environmental | Open in IMG/M |
| 3300019732 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_0-1_MG | Environmental | Open in IMG/M |
| 3300019738 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_0-1_MG | Environmental | Open in IMG/M |
| 3300019739 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_8-9_MG | Environmental | Open in IMG/M |
| 3300022206 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022306 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025550 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025563 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025565 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025797 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025801 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025813 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025823 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025895 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025947 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025954 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025977 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_PWC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026012 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027612 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027822 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027865 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21 | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031371 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-10 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031553 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-240 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Host-Associated | Open in IMG/M |
| 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Host-Associated | Open in IMG/M |
| 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Host-Associated | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032136 | Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow | Environmental | Open in IMG/M |
| 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032251 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic | Environmental | Open in IMG/M |
| 3300032252 | Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cm | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032259 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032262 | Coastal sediment microbial communities from Maine, United States - Cross River sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300032273 | Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A oxic | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TDF_OR_ARG04_113mDRAFT_10363392 | 3300000121 | Marine | MAAPLMHESPRCAGQPYATAQPAVAGTITRIDSVDSARVSEKKYKK* |
| TDF_OR_ARG04_123mDRAFT_10002026 | 3300000122 | Marine | MAAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKKYQK* |
| SA_S2_NOR15_50mDRAFT_100755572 | 3300000130 | Marine | MAAPLMREPTRCTVQPNVTVQRAVASTIMRIDSVDSGRVNKKK* |
| BS_KBA_SWE21_205mDRAFT_100905561 | 3300000241 | Marine | MAALIWRDPPRCAEQPYATVQRAVASTIMRIDSVDSGRVKEKKHKK* |
| TDF_OR_ARG05_123mDRAFT_10213261 | 3300000242 | Marine | MFTALMAAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKKYQK* |
| JGI24023J19991_101523851 | 3300001750 | Marine | MFIAPMAAPLMHEPPRCAGQPYATAQPAVAGTIMRIDSVDSGRVNEKK* |
| BRMGV_10331872 | 3300002495 | Mangrove Soil | VLIGRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK* |
| FeGlu_101377605 | 3300002988 | Wetland Sediment | MAALIWRDPPRCTGQPNVTVQRAVASTIMRIDSVGSGRANEKK* |
| Ga0055448_101016261 | 3300004005 | Natural And Restored Wetlands | MFIARMAAPTMHEPLRCAEQPNATAQLAVAGTVMRIDSVDSGRVNEKK* |
| Ga0055432_100250251 | 3300004022 | Natural And Restored Wetlands | MAAPLMREPTRCTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK* |
| Ga0055498_100144522 | 3300004058 | Natural And Restored Wetlands | MAAPLMREPTRCTVQPNVTVQRAVAGTVMRIDSVDSGRVKEKKYKK* |
| Ga0055488_101328372 | 3300004070 | Natural And Restored Wetlands | IAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK* |
| Ga0070727_102803512 | 3300005590 | Marine Sediment | MVALIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK* |
| Ga0070726_102925092 | 3300005600 | Marine Sediment | ALIWRDPPRCTVQPNVTVQRAVASTIMRIDSVDSGRVNEKK* |
| Ga0070723_102560421 | 3300005612 | Marine Sediment | MVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK* |
| Ga0078746_10305442 | 3300005821 | Marine Sediment | MVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKKYQK* |
| Ga0074469_106743322 | 3300005832 | Sediment (Intertidal) | MAAPLMHEPPRCAGQPNVTVQRAVAGTIMPIDSVDSARVNEKKYKK* |
| Ga0074470_102073672 | 3300005836 | Sediment (Intertidal) | MSIAPMAAPTMHEPPRCAEQPNVTVQRAVASTVMRIDSVGSGRVSEKK* |
| Ga0115360_100021742 | 3300008465 | Sediment | MTALIWRDQTRCTVQPNXTVQRAVASTIMRIDSAGSGRVNDKK* |
| Ga0102958_11800901 | 3300009035 | Soil | MVVLIWRDPPRCAGQPNATVQPAVAGTRMRIDSAASGRVNEKK* |
| Ga0129286_103128471 | 3300009515 | Sediment | VLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK* |
| Ga0114931_100574151 | 3300009702 | Deep Subsurface | MAVLIWRDQTRCNEQPNVTVQHAVASTIMRIDSADSGRANDKK* |
| Ga0118731_1091108131 | 3300010392 | Marine | MSIALTAALISRDPPRCAERPNATVQRAVAGTVMRTDSVGSGRVNEKKYQK* |
| Ga0118731_1100978531 | 3300010392 | Marine | MAALIWHDPIRCTAQPNATVQLAVVSTVMRLDSIGSGRVNEKK* |
| Ga0118731_1126710572 | 3300010392 | Marine | MVVLIWRDPPRCVGHLNATVQPAVAGTRMRIDSTDSGRVNEKK* |
| Ga0118731_1142362864 | 3300010392 | Marine | MFIALMAAPLMREPPRCAGPPNATVQPAVAGTIMRIDSTDSGRANEKKHQK* |
| Ga0118733_1026519002 | 3300010430 | Marine Sediment | MSIALTAALISREPPRCAEWPNATVQRAMAGTVMRIDSVGSGRVNEKKYQK* |
| Ga0118733_1037789351 | 3300010430 | Marine Sediment | MFTALMAAPLMHEPPRCTGQLNATAQRAVAGTVMRIDSADSGRDNEKK* |
| Ga0139246_10967752 | 3300010969 | Hydrothermal Chimney Microbial Mat | MFIAPMAVLIWRDPHRCAEPPSVTVQRVVAGTIMRIDSAASGRANEKKYQK* |
| Ga0139324_11478411 | 3300010997 | Sediment | MSIALLAVPIRHDPIRCAERPNATVQLAVAGTIMRIDSADSGRVNEKK* |
| Ga0151668_10605731 | 3300011262 | Marine | MAVLILRDPPRCAGQPNATVQPAVAGTVMRIDSAGSGRVNEKK* |
| Ga0075307_10364212 | 3300014260 | Natural And Restored Wetlands | ALTAAPIWREPPRCTVQPNVTVQPVAAGTVMRIDSVDSGRVKDKKYKK* |
| Ga0075308_10138371 | 3300014264 | Natural And Restored Wetlands | MFIALTAAPIWREPPRCTVQPNVTVQPVAAGTVMRIDSVDSGRVNEKKYKK* |
| Ga0075308_10260931 | 3300014264 | Natural And Restored Wetlands | MFIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK* |
| Ga0075305_10302562 | 3300014295 | Natural And Restored Wetlands | MFIALTAAPIWREPPRCTVQPNVTVQPVAAGTVMRIDSVDSGRVNEKK* |
| Ga0075305_10827411 | 3300014295 | Natural And Restored Wetlands | MFIAPMAAPLMRAPPHCAEPPYATVQPAVAGTVMRIDSVGSGRVSEKK* |
| Ga0075344_10492191 | 3300014296 | Natural And Restored Wetlands | MFIAPMAAPTMHEPPRCAERPNATVQRAVAGTVMRIDSAGSGRANEKK* |
| Ga0075344_10590972 | 3300014296 | Natural And Restored Wetlands | MAAPLMREPTRCTVQPNVTVQRAVASTVMRIDSVDSGRVNEKK* |
| Ga0075306_10602542 | 3300014297 | Natural And Restored Wetlands | MSIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK* |
| Ga0075303_10461941 | 3300014299 | Natural And Restored Wetlands | MFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVDSGRVKEKKYKK* |
| Ga0180084_10690302 | 3300014874 | Soil | MFIAPMAAPLMRAPPHCAEPPYATVQPAVAGTVMRIDSVGSGRASEKK* |
| Ga0194017_10019613 | 3300019696 | Sediment | MVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0193987_10096642 | 3300019713 | Sediment | MVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGR |
| Ga0193975_10270372 | 3300019714 | Sediment | SIVRMVVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0193999_10073482 | 3300019718 | Sediment | VLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0194014_10005061 | 3300019732 | Sediment | MAAPLMHEPPRCAGQPNATVQPAVAGTVMPIDSDGSGRVNEKK |
| Ga0193994_10406112 | 3300019738 | Sediment | MAAPLMHEPPRCAGQPNATAQRAVAGTLMRIDSADSGRDNEKK |
| Ga0194012_10329942 | 3300019739 | Sediment | MAAPLMHEPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0224499_102053141 | 3300022206 | Sediment | MVVLIWRAPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0224509_102844421 | 3300022306 | Sediment | PPRCAGQPNATAQRAVAGTVMRIDSADSGRDNEKK |
| (restricted) Ga0233409_100183582 | 3300022938 | Seawater | MVVLIWRDPPRCTVQPNVTVQRAVASTIMRIDSVGSGRVNEKK |
| (restricted) Ga0233409_102274052 | 3300022938 | Seawater | MAAPLMHEPPRCAGQPNATAQRAVAGTVMRIDSADSGRDNEKK |
| (restricted) Ga0255051_101476222 | 3300024057 | Seawater | MAVLIWHDPIRCTAQPNATVQPAVAGTVMRIDSIGSERVNEKK |
| Ga0210083_10190832 | 3300025521 | Natural And Restored Wetlands | MAAPLMREPTRCTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK |
| Ga0210098_10402262 | 3300025550 | Natural And Restored Wetlands | MAAPLMREPTRCTVQPNVTVQRAVAGTVMRIDSVDSGRVKEKKYKK |
| Ga0210131_10462542 | 3300025551 | Natural And Restored Wetlands | VTAVMSIARMAAPIWRDPPRCAGQPYATVQRAVASTIMRIDSVDSGRVKEKKHKK |
| Ga0210139_10836541 | 3300025558 | Natural And Restored Wetlands | TAAMFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVDSGRVNEKK |
| Ga0210108_10532241 | 3300025560 | Natural And Restored Wetlands | MFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVDSGRVNEKK |
| Ga0210112_10994551 | 3300025563 | Natural And Restored Wetlands | AVTSIALTTALIWRDPPRCTEQPNVTVQRAVAGTVMRIDSAGSGRVNEKK |
| Ga0210110_10026766 | 3300025565 | Natural And Restored Wetlands | MFIVPMAAPTMHELPHCAEQPNVTVQRAVAGTVMRIDSVGSGRVNEKK |
| Ga0210110_10336771 | 3300025565 | Natural And Restored Wetlands | MFIARMAAPTMHEPLRCAEQPNATAQLAVAGTVMRIDSVDSGRVNEKK |
| Ga0210110_10585482 | 3300025565 | Natural And Restored Wetlands | MAAPFMREPPRFVGQPNATVQHAVVGTVMRVDSVDSERVNEKK |
| Ga0210062_10240432 | 3300025797 | Natural And Restored Wetlands | MAAPLMREPTRYTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK |
| Ga0210097_10188772 | 3300025801 | Natural And Restored Wetlands | MFIVPMAAPTMHEPPHYAEQPNVTVQRAVAGTVMRIDSVGSGRVNEKK |
| Ga0210097_10269272 | 3300025801 | Natural And Restored Wetlands | MSIALTAALIWRDPPRCAERPNATVQRAVAGTVMRIDSAGSGRVSEKK |
| Ga0210064_10019925 | 3300025813 | Natural And Restored Wetlands | MVALIWRDPPRCAGQPNATVQPVVAGTVMPIDSVGSGRVNEKKYQK |
| Ga0210123_10338552 | 3300025823 | Natural And Restored Wetlands | MREPTRYTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK |
| Ga0209456_102221741 | 3300025883 | Pelagic Marine | MSIALTAVRIWRDPPRCAERPNATVQRAVAGTVMRIDSVASGRVNEKK |
| Ga0209567_104153462 | 3300025895 | Pelagic Marine | MAAPLMHESPRCAGQPNATAQRAVAGTVMRIDSADSGRDNEKK |
| Ga0209567_104697012 | 3300025895 | Pelagic Marine | VLSWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0210067_10079321 | 3300025947 | Natural And Restored Wetlands | MFIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK |
| Ga0210135_10254991 | 3300025954 | Natural And Restored Wetlands | TSIVRMAAPLMREPTRCTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK |
| Ga0210072_10483231 | 3300025977 | Natural And Restored Wetlands | AAPLMHEPPRYAGQPNVTVQRAVASTIMRIDSAGSGRVNEKKYKK |
| Ga0210124_11429391 | 3300026007 | Natural And Restored Wetlands | MFIARMAAPTMHEPLRCAEQPNATAQLAVAGTVMRIDSADSGRVNEKK |
| Ga0208653_10051462 | 3300026012 | Natural And Restored Wetlands | MSIAPMAAPTMHEPPRCAARPNATVQRAVAGTVMRIDSAGSGRANEKK |
| Ga0209037_11196302 | 3300027612 | Marine | SIALTAARIWHDQPRCTEQPNVTVQPAVASTIMRIDSVDSGRVNEKK |
| Ga0209273_103139512 | 3300027790 | Marine Sediment | MAAPLMHEPPRCTGQLNATAQRAVAGTVMRIDSADSGRDNEKK |
| Ga0209633_104463271 | 3300027822 | Marine | MFIAPMAAPLMHEPPRCAGQPYATAQPAVAGTIMRIDSVDSGRVNEKK |
| (restricted) Ga0255052_101706842 | 3300027865 | Seawater | TLTAATSIVRMAVLIWHDPIRCTAQPNATVQPAVAGTVMRIDSIGSERVNEKK |
| (restricted) Ga0255055_102434732 | 3300027881 | Seawater | MAVLIWHDPIRCTAQPNATVQPAVVSTVMRLDRFGSERVNEKK |
| Ga0265306_101900532 | 3300028598 | Sediment | APLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKK |
| Ga0265306_102060452 | 3300028598 | Sediment | MSIARTAALIWRDRPRCAERPNATVQPAVAGTLMRIDSVGSGRVNEKK |
| Ga0265306_104165152 | 3300028598 | Sediment | MAAPLMHEPPRCAGQPNATAQHAVAGTVMRIDSADSGRDNEKK |
| Ga0265306_105871751 | 3300028598 | Sediment | MAAPLMREPTRCTVQPNVTVQRAVASTIMRIDSVDSGLVNEKKYQK |
| Ga0265306_106253211 | 3300028598 | Sediment | PIRHVPPRCAERPNAIVQLAKAGTAMRPDNASSERIKNKK |
| Ga0265309_106656281 | 3300028599 | Sediment | MVVLIWRDPPRCVGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0265303_107955651 | 3300028600 | Sediment | MFIALMAAPFMREPPRCAERPNATVPLAVAGTVMRIDSADSGRVNEKK |
| Ga0307423_10814032 | 3300031371 | Salt Marsh | MFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVGSGRVNEKK |
| Ga0307380_101080341 | 3300031539 | Soil | VRMAAPIWRDPPRCTGQPNVTVQRAVASTLMRIDSVDSGRVSEKK |
| Ga0315547_10527253 | 3300031553 | Salt Marsh Sediment | SIVRMAAPLMREPTRCTVQPNVTVQRAVASTLMRIDSVDSGRVNEKK |
| Ga0307379_100778101 | 3300031565 | Soil | MAAPIWRDPPRCTGQPNVTVQRAVASTLMRIDSVDSGRVSEKK |
| Ga0316575_101023141 | 3300031665 | Rhizosphere | MFIVPMAAPTMHEPPHCAEQPNVTVQRAVAGTVMRIDSVGSGCVNEKK |
| Ga0316576_104357241 | 3300031727 | Rhizosphere | MAAPIRPDPPRCAEPPNATVQRAVAGTVMRTDSGGSGRVNEKK |
| Ga0316578_103873301 | 3300031728 | Rhizosphere | MFIALTAAPIWHDPPRCAGQPYATVQRAAAGTVMRIDSVDSGRVKEKKYKK |
| Ga0315540_102182362 | 3300032061 | Salt Marsh Sediment | SVVTATTAMFIARMAAPTMHEPLRCAEQPNATAQLAVAGTVMRIDSVDSGRVNEKK |
| Ga0316201_109406482 | 3300032136 | Worm Burrow | MSIALLAAPVMRDPPHCAERPNATVHLAVVGIAMRIDSVGSGRVNEKK |
| Ga0316593_101622102 | 3300032168 | Rhizosphere | AVLIWRDPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0316187_100287937 | 3300032231 | Worm Burrow | MAAPLMREPTRCTVQPNVTVQRAVASTIMRIDSVDSGRVNKKK |
| Ga0316187_104488682 | 3300032231 | Worm Burrow | MAAPLMHEPPRYAGQPNVTVQRAVAGTIMPIDSVDSARVNEKKYKK |
| Ga0316187_104760152 | 3300032231 | Worm Burrow | MVVLIWRDPPRCAGQPNATAQRAVAGTVMPIDSADSGRDNEKK |
| Ga0316187_106675631 | 3300032231 | Worm Burrow | MAALIWHDPIRCTAQPNATVQLAVVSTVMRLDSIGSVRVNEKK |
| Ga0316198_105405432 | 3300032251 | Sediment | TALMAAPLMHEPPRCAGQPNATAQRAVAGTVMRIDSADSGRDNEKK |
| Ga0316196_103854232 | 3300032252 | Sediment | TVRMAAPIWRDPPRCTVQPNVTVQRAVASTIMRIDSVGSGRVNEKK |
| Ga0316191_106443562 | 3300032258 | Worm Burrow | MAAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKKYQK |
| Ga0316190_102268932 | 3300032259 | Worm Burrow | APLMHEPPRCAGQLNATAQRALAGTVMRIDSADSGRDNEKKYQK |
| Ga0316190_106295201 | 3300032259 | Worm Burrow | MAAPLMHEPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKKYQK |
| Ga0316190_107935902 | 3300032259 | Worm Burrow | MAAPLMHEPPRCAGQLNATAQRAVAGTVMRIDSADSGRDNEKK |
| Ga0316192_104423572 | 3300032260 | Worm Burrow | MAAPIWRDPPRCTVQPNVTVQRAVASTIMRIDSVGSGRVNEKK |
| Ga0316192_104523171 | 3300032260 | Worm Burrow | MAAPLMHEPPRYAGQPNVIVQHAVAGTIMPIDSVDSARVNEKKYKK |
| Ga0316192_107460402 | 3300032260 | Worm Burrow | MFIVRTAAPLMRELPRCTEQPYATVQRAVAGTVMPIDSVDSGRVNEKK |
| Ga0316194_106329861 | 3300032262 | Sediment | MFTALMAAPLMHEPPRCAGQLNATAQRAVAGTRMRIDSTDSGRVNEKK |
| Ga0316189_101211494 | 3300032272 | Worm Burrow | DPPRCAGQPNATVQPAVAGTVMPIDSVGSGRVNEKK |
| Ga0316197_104634031 | 3300032273 | Sediment | TVRMAAPIWRDPPRCAEQPCATAQHVVAGTVMRIDSVDSGRVNEKK |
| ⦗Top⦘ |