| Basic Information | |
|---|---|
| Family ID | F055778 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 138 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MLSNVDLPEPELPTIKTTSPCSIENDTSSRALTLLSPSP |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 138 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 23.91 % |
| % of genes from short scaffolds (< 2000 bps) | 65.22 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.21 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (72.464 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (11.594 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.333 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.39% β-sheet: 0.00% Coil/Unstructured: 77.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 138 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 35.51 |
| PF02687 | FtsX | 27.54 |
| PF12704 | MacB_PCD | 21.74 |
| PF00293 | NUDIX | 1.45 |
| PF13412 | HTH_24 | 1.45 |
| PF03109 | ABC1 | 1.45 |
| PF00924 | MS_channel | 0.72 |
| PF00543 | P-II | 0.72 |
| PF16886 | ATP-synt_ab_Xtn | 0.72 |
| PF13685 | Fe-ADH_2 | 0.72 |
| PF01137 | RTC | 0.72 |
| PF13404 | HTH_AsnC-type | 0.72 |
| PF05670 | NFACT-R_1 | 0.72 |
| PF01092 | Ribosomal_S6e | 0.72 |
| PF01096 | TFIIS_C | 0.72 |
| PF07992 | Pyr_redox_2 | 0.72 |
| PF02006 | PPS_PS | 0.72 |
| PF02548 | Pantoate_transf | 0.72 |
| PF13847 | Methyltransf_31 | 0.72 |
| PF01321 | Creatinase_N | 0.72 |
| COG ID | Name | Functional Category | % Frequency in 138 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 1.45 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.72 |
| COG0347 | Nitrogen regulatory protein PII | Signal transduction mechanisms [T] | 0.72 |
| COG0413 | Ketopantoate hydroxymethyltransferase | Coenzyme transport and metabolism [H] | 0.72 |
| COG0430 | RNA 3'-terminal phosphate cyclase | RNA processing and modification [A] | 0.72 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| COG1293 | Ribosome quality control (RQC) protein RqcH, Rqc2/NEMF/Tae2 family, contains fibronectin-(FbpA) and RNA- (NFACT) binding domains | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG1594 | DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS | Transcription [K] | 0.72 |
| COG1701 | Archaeal phosphopantothenate synthetase | Coenzyme transport and metabolism [H] | 0.72 |
| COG2125 | Ribosomal protein S6E (S10) | Translation, ribosomal structure and biogenesis [J] | 0.72 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.72 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.46 % |
| Unclassified | root | N/A | 27.54 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2049941003|GB_4MN_4MetaGsffNew_c561 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 4307 | Open in IMG/M |
| 3300000158|SI54feb11_100mDRAFT_c1021362 | Not Available | 1104 | Open in IMG/M |
| 3300000195|SI39nov08_150mDRAFT_c1001846 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 3430 | Open in IMG/M |
| 3300000262|LP_A_09_P04_1300DRAFT_1041704 | Not Available | 629 | Open in IMG/M |
| 3300001270|BBAY91_10017846 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 1655 | Open in IMG/M |
| 3300001683|GBIDBA_10106014 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1273 | Open in IMG/M |
| 3300001683|GBIDBA_10157441 | Not Available | 547 | Open in IMG/M |
| 3300001959|GOS2247_1047155 | Not Available | 1344 | Open in IMG/M |
| 3300002231|KVRMV2_100020466 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1359 | Open in IMG/M |
| 3300002231|KVRMV2_100713627 | Not Available | 522 | Open in IMG/M |
| 3300002516|FJ528644_10000026 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 59527 | Open in IMG/M |
| 3300002913|JGI26060J43896_10003594 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 5610 | Open in IMG/M |
| 3300002913|JGI26060J43896_10026626 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1790 | Open in IMG/M |
| 3300002913|JGI26060J43896_10111660 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 706 | Open in IMG/M |
| 3300002913|JGI26060J43896_10135179 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 626 | Open in IMG/M |
| 3300002919|JGI26061J44794_1012851 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2125 | Open in IMG/M |
| 3300002965|JGI26063J44948_1044402 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 875 | Open in IMG/M |
| 3300003098|Ga0052264_102069 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 30546 | Open in IMG/M |
| 3300003254|Pfc106_1000033 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 41363 | Open in IMG/M |
| 3300003455|KH04A_1265764 | Not Available | 507 | Open in IMG/M |
| 3300003591|JGI26250J51715_1052836 | Not Available | 618 | Open in IMG/M |
| 3300003595|JGI26263J51726_1002072 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 6755 | Open in IMG/M |
| 3300003830|Ga0051980_10005025 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 9965 | Open in IMG/M |
| 3300003847|Ga0055582_1007792 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2053 | Open in IMG/M |
| 3300003894|Ga0063241_1010458 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 5415 | Open in IMG/M |
| 3300003937|Ga0063391_1000812 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 16389 | Open in IMG/M |
| 3300003991|Ga0055461_10058026 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 914 | Open in IMG/M |
| 3300004019|Ga0055439_10018807 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 1634 | Open in IMG/M |
| 3300004106|Ga0065180_10044462 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1443 | Open in IMG/M |
| 3300004185|Ga0066642_10132215 | Not Available | 811 | Open in IMG/M |
| 3300004369|Ga0065726_10255 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 78843 | Open in IMG/M |
| 3300005218|Ga0068996_10123778 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 610 | Open in IMG/M |
| 3300005239|Ga0073579_1678954 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3358 | Open in IMG/M |
| 3300005399|Ga0066860_10003798 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 6509 | Open in IMG/M |
| 3300005588|Ga0070728_10254007 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 965 | Open in IMG/M |
| 3300005600|Ga0070726_10149279 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1206 | Open in IMG/M |
| 3300005612|Ga0070723_10077920 | Not Available | 1375 | Open in IMG/M |
| 3300005783|Ga0078430_100286 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 7752 | Open in IMG/M |
| 3300005785|Ga0078432_102820 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1466 | Open in IMG/M |
| 3300005824|Ga0074474_1619032 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 38939 | Open in IMG/M |
| 3300005828|Ga0074475_10382925 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1625 | Open in IMG/M |
| 3300005830|Ga0074473_10193571 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 2808 | Open in IMG/M |
| 3300005836|Ga0074470_10733116 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 15564 | Open in IMG/M |
| 3300005838|Ga0008649_10167088 | Not Available | 870 | Open in IMG/M |
| 3300006467|Ga0099972_13109348 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 884 | Open in IMG/M |
| 3300006468|Ga0082251_10000004 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 58232 | Open in IMG/M |
| 3300006468|Ga0082251_10024310 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2149 | Open in IMG/M |
| 3300006841|Ga0068489_151281 | Not Available | 1013 | Open in IMG/M |
| 3300006874|Ga0075475_10139268 | Not Available | 1071 | Open in IMG/M |
| 3300007504|Ga0104999_1075718 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1397 | Open in IMG/M |
| 3300007614|Ga0102946_1000241 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 19266 | Open in IMG/M |
| 3300007619|Ga0102947_1215340 | Not Available | 699 | Open in IMG/M |
| 3300007765|Ga0105010_1051510 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1525 | Open in IMG/M |
| 3300008253|Ga0105349_10439111 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 545 | Open in IMG/M |
| 3300008464|Ga0115336_117525 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1911 | Open in IMG/M |
| 3300009030|Ga0114950_10124385 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2067 | Open in IMG/M |
| 3300009030|Ga0114950_10280666 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1343 | Open in IMG/M |
| 3300009030|Ga0114950_10354312 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1179 | Open in IMG/M |
| 3300009102|Ga0114948_10091645 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2005 | Open in IMG/M |
| 3300009102|Ga0114948_10308821 | Not Available | 1168 | Open in IMG/M |
| 3300009173|Ga0114996_10061082 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3340 | Open in IMG/M |
| 3300009476|Ga0115555_1385166 | Not Available | 559 | Open in IMG/M |
| 3300009514|Ga0129284_10016454 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3591 | Open in IMG/M |
| 3300009515|Ga0129286_10015444 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1764 | Open in IMG/M |
| 3300009515|Ga0129286_10252809 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 618 | Open in IMG/M |
| 3300009702|Ga0114931_10005988 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 15027 | Open in IMG/M |
| 3300009702|Ga0114931_10027015 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 6196 | Open in IMG/M |
| 3300009702|Ga0114931_10149211 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 1890 | Open in IMG/M |
| 3300009706|Ga0115002_10247799 | Not Available | 1364 | Open in IMG/M |
| 3300009777|Ga0105164_10182531 | Not Available | 1068 | Open in IMG/M |
| 3300009797|Ga0105080_1037043 | Not Available | 574 | Open in IMG/M |
| 3300009805|Ga0105079_1025415 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 594 | Open in IMG/M |
| 3300010234|Ga0136261_1051887 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 886 | Open in IMG/M |
| 3300010391|Ga0136847_11635797 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2034 | Open in IMG/M |
| 3300010392|Ga0118731_109124843 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 980 | Open in IMG/M |
| 3300010430|Ga0118733_100645719 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2107 | Open in IMG/M |
| 3300010968|Ga0139250_1110174 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1582 | Open in IMG/M |
| 3300010969|Ga0139246_1037437 | Not Available | 1507 | Open in IMG/M |
| 3300011013|Ga0114934_10005287 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 7869 | Open in IMG/M |
| 3300011013|Ga0114934_10194258 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 942 | Open in IMG/M |
| 3300011112|Ga0114947_10411819 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 946 | Open in IMG/M |
| 3300012671|Ga0137318_1000164 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 3192 | Open in IMG/M |
| 3300013233|Ga0172420_10085133 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae | 2430 | Open in IMG/M |
| 3300014269|Ga0075302_1155358 | Not Available | 558 | Open in IMG/M |
| 3300017950|Ga0181607_10696250 | Not Available | 528 | Open in IMG/M |
| 3300020230|Ga0212167_1082741 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1679 | Open in IMG/M |
| 3300020230|Ga0212167_1258615 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1201 | Open in IMG/M |
| 3300020231|Ga0212168_1066870 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3026 | Open in IMG/M |
| 3300020231|Ga0212168_1396230 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2735 | Open in IMG/M |
| 3300020231|Ga0212168_1416908 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1547 | Open in IMG/M |
| 3300020300|Ga0211662_1000037 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 47532 | Open in IMG/M |
| 3300020399|Ga0211623_10049459 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1430 | Open in IMG/M |
| 3300021084|Ga0206678_10274916 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 816 | Open in IMG/M |
| 3300021089|Ga0206679_10380891 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 752 | Open in IMG/M |
| 3300021958|Ga0222718_10219235 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1028 | Open in IMG/M |
| 3300021958|Ga0222718_10337109 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 771 | Open in IMG/M |
| 3300022202|Ga0224498_10026401 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1600 | Open in IMG/M |
| 3300022209|Ga0224497_10001279 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 16182 | Open in IMG/M |
| 3300022220|Ga0224513_10128021 | Not Available | 978 | Open in IMG/M |
| 3300022413|Ga0224508_10559732 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 709 | Open in IMG/M |
| (restricted) 3300022888|Ga0233428_1000094 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 137436 | Open in IMG/M |
| 3300024236|Ga0228655_1086756 | Not Available | 677 | Open in IMG/M |
| 3300024344|Ga0209992_10021897 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3429 | Open in IMG/M |
| (restricted) 3300024521|Ga0255056_10010552 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3235 | Open in IMG/M |
| 3300025005|Ga0210005_1097817 | Not Available | 782 | Open in IMG/M |
| 3300025007|Ga0210038_1040001 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis | 1271 | Open in IMG/M |
| 3300025150|Ga0210057_1064445 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2597 | Open in IMG/M |
| 3300025243|Ga0208335_1006821 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2223 | Open in IMG/M |
| 3300025596|Ga0209662_1036188 | Not Available | 1369 | Open in IMG/M |
| 3300025680|Ga0209306_1077130 | Not Available | 1019 | Open in IMG/M |
| 3300025722|Ga0209660_1221170 | Not Available | 593 | Open in IMG/M |
| 3300025869|Ga0209308_10208694 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 861 | Open in IMG/M |
| 3300025883|Ga0209456_10348426 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 606 | Open in IMG/M |
| 3300025985|Ga0210117_1023215 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus | 920 | Open in IMG/M |
| 3300026108|Ga0208391_1000015 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 68182 | Open in IMG/M |
| 3300026144|Ga0209954_1002816 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 3281 | Open in IMG/M |
| 3300026479|Ga0228622_1064181 | Not Available | 814 | Open in IMG/M |
| 3300027191|Ga0208021_1015873 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 1148 | Open in IMG/M |
| 3300027582|Ga0208971_1146403 | Not Available | 507 | Open in IMG/M |
| 3300027704|Ga0209816_1124196 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 964 | Open in IMG/M |
| 3300027758|Ga0209379_10062657 | Not Available | 1389 | Open in IMG/M |
| 3300027779|Ga0209709_10004598 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 11063 | Open in IMG/M |
| 3300027827|Ga0209035_10082174 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1583 | Open in IMG/M |
| 3300027827|Ga0209035_10095883 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis | 1464 | Open in IMG/M |
| 3300027827|Ga0209035_10207600 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 978 | Open in IMG/M |
| 3300027845|Ga0209271_10093188 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1247 | Open in IMG/M |
| 3300027978|Ga0209165_10018190 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2468 | Open in IMG/M |
| 3300028598|Ga0265306_10158351 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 1190 | Open in IMG/M |
| 3300028599|Ga0265309_11097529 | Not Available | 551 | Open in IMG/M |
| 3300028600|Ga0265303_11266284 | Not Available | 614 | Open in IMG/M |
| 3300031588|Ga0302137_1295895 | Not Available | 530 | Open in IMG/M |
| 3300031623|Ga0302123_10151104 | Not Available | 1200 | Open in IMG/M |
| 3300031629|Ga0307985_10182687 | Not Available | 829 | Open in IMG/M |
| 3300031775|Ga0315326_10483787 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 797 | Open in IMG/M |
| 3300031801|Ga0310121_10728168 | Not Available | 523 | Open in IMG/M |
| 3300031804|Ga0310124_10496490 | Not Available | 714 | Open in IMG/M |
| 3300032011|Ga0315316_10072226 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus | 2784 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 11.59% |
| Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 6.52% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 6.52% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 5.07% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 4.35% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 4.35% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 4.35% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.90% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.90% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.90% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 2.90% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.90% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.17% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.17% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.17% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.17% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.45% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.45% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.45% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.45% |
| Hydrothermal Chimney Microbial Mat | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat | 1.45% |
| Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 1.45% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.45% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.45% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.72% |
| Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.72% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.72% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.72% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.72% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.72% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.72% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.72% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.72% |
| Water Column | Environmental → Aquatic → Marine → Coastal → Unclassified → Water Column | 0.72% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.72% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.72% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.72% |
| Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.72% |
| Marine Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Sediment | 0.72% |
| Marine | Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine | 0.72% |
| Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents | 0.72% |
| Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.72% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.72% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.72% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
| Marine Sponge Petrosia Ficiformis Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Sponge Petrosia Ficiformis Associated | 0.72% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.72% |
| Orange Tunicate | Host-Associated → Tunicates → Ascidians → Unclassified → Unclassified → Orange Tunicate | 0.72% |
| Sediment | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Sediment | 0.72% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2049941003 | Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 420 | Environmental | Open in IMG/M |
| 3300000158 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 54 02/08/11 100m | Environmental | Open in IMG/M |
| 3300000195 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 150m | Environmental | Open in IMG/M |
| 3300000262 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P04_1300 | Environmental | Open in IMG/M |
| 3300001270 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY91 | Host-Associated | Open in IMG/M |
| 3300001683 | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly | Environmental | Open in IMG/M |
| 3300001959 | Mangrove swamp microbial communities from Isabella Island, Equador - GS032 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002516 | Host associated Microbial communities of an Orange Tunicate from Islas Murcielagos, Costa Rica -Sample 27904 | Host-Associated | Open in IMG/M |
| 3300002913 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300002919 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300002965 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LV | Environmental | Open in IMG/M |
| 3300003098 | Marine microbial communities from surface seawater at Gulf of Maine | Environmental | Open in IMG/M |
| 3300003254 | Marine sponge Petrosia ficiformis associated microbial communities from Achziv, Israel - Sample 106 | Host-Associated | Open in IMG/M |
| 3300003455 | Marine sediment microbial communities from Douglas Channel, Canada, that are oil-degrading - Sample S16-KH04A | Environmental | Open in IMG/M |
| 3300003591 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_150m_DNA | Environmental | Open in IMG/M |
| 3300003595 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_200m_DNA | Environmental | Open in IMG/M |
| 3300003830 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter | Environmental | Open in IMG/M |
| 3300003847 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 | Environmental | Open in IMG/M |
| 3300003894 | Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessment | Environmental | Open in IMG/M |
| 3300003937 | SPOT_150m_metagenome_year | Environmental | Open in IMG/M |
| 3300003991 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004106 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 0.2 um filter (version 2) | Environmental | Open in IMG/M |
| 3300004185 | Groundwater microbial communities from aquifer - Crystal Geyser CG13_big_fil_rev_8/21/14_2.50 | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005399 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005783 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IX | Environmental | Open in IMG/M |
| 3300005785 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten VI | Environmental | Open in IMG/M |
| 3300005824 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.180_BBC | Environmental | Open in IMG/M |
| 3300005828 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBI | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005838 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNA | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006468 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Combined Assembly of Gp0119454, Gp0119453, Gp0119452, Gp0119451 | Environmental | Open in IMG/M |
| 3300006841 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT234_2_0200m | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007504 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 267m, 2.7-0.2um, replicate a | Environmental | Open in IMG/M |
| 3300007614 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D1_MG | Environmental | Open in IMG/M |
| 3300007619 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MG | Environmental | Open in IMG/M |
| 3300007765 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
| 3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
| 3300008464 | Deep sea sediment microbial communities from the Gulf of Mexico ? treatment with crude oil and Corexit | Engineered | Open in IMG/M |
| 3300009030 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaG | Environmental | Open in IMG/M |
| 3300009102 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009476 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 | Environmental | Open in IMG/M |
| 3300009514 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1W | Environmental | Open in IMG/M |
| 3300009515 | Microbial community of beach aquifer sediment core from Cape Shores, Lewes, Delaware, USA - CF-2 | Environmental | Open in IMG/M |
| 3300009702 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV14_V59a metaG | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
| 3300009797 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 | Environmental | Open in IMG/M |
| 3300009805 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10 | Environmental | Open in IMG/M |
| 3300010234 | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010968 | Microbial communities from the middle layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.mid | Environmental | Open in IMG/M |
| 3300010969 | Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.out | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011112 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR02 metaG | Environmental | Open in IMG/M |
| 3300012671 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2 | Environmental | Open in IMG/M |
| 3300013233 | Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161 | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020230 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02 | Environmental | Open in IMG/M |
| 3300020231 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04 | Environmental | Open in IMG/M |
| 3300020300 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555977-ERR598981) | Environmental | Open in IMG/M |
| 3300020399 | Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947) | Environmental | Open in IMG/M |
| 3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
| 3300021089 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022209 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022220 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022888 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MG | Environmental | Open in IMG/M |
| 3300024236 | Seawater microbial communities from Monterey Bay, California, United States - 67D | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024521 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1 | Environmental | Open in IMG/M |
| 3300025005 | Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 0.2 um filter (SPAdes) | Environmental | Open in IMG/M |
| 3300025007 | Groundwater microbial communities from aquifer - Crystal Geyser CG15_big_fil_post_rev_8/21/14_0.20 (SPAdes) | Environmental | Open in IMG/M |
| 3300025150 | Groundwater microbial communities from aquifer - Crystal Geyser CG10_big_fil_rev_8/21/14_0.10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025243 | Marine microbial communities from the Deep Atlantic Ocean - MP0759 (SPAdes) | Environmental | Open in IMG/M |
| 3300025596 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
| 3300025722 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025869 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes) | Environmental | Open in IMG/M |
| 3300025883 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026108 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_Bottom_ad_3770_LV_A (SPAdes) | Environmental | Open in IMG/M |
| 3300026144 | Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300027191 | Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes) | Environmental | Open in IMG/M |
| 3300027582 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027704 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027827 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027978 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028599 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300028600 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031588 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_SCM | Environmental | Open in IMG/M |
| 3300031623 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GB_4MN_01080230 | 2049941003 | Hydrothermal Vents | MFNNVDFPEPELPTIKTTSPCSIEKDTSSRALTLLSPSP |
| SI54feb11_100mDRAFT_10213621 | 3300000158 | Marine | IFNNVDFPEPELPTIKTTSPCSIEKDTSSRAFTLLSPSP* |
| SI39nov08_150mDRAFT_10018461 | 3300000195 | Marine | NNVDFPEPELPTIKTTSPCSIEKDTSSRAFTLLSPSP* |
| LP_A_09_P04_1300DRAFT_10417042 | 3300000262 | Marine | FNNVDFPEPELPTIKTTSPCSIEKDTSSRALTLLSPSP* |
| BBAY91_100178462 | 3300001270 | Macroalgal Surface | MFSNVDLPEPELPTIKTNSPCLIENDTSSRALTLLSP* |
| GBIDBA_101060143 | 3300001683 | Hydrothermal Vent Plume | DLPEPELPTIKTTSPCSIDNDTLSRALTLLSPSP* |
| GBIDBA_101574411 | 3300001683 | Hydrothermal Vent Plume | DLPEPELPTIKTTSPCSIDNDTLSRALTLLTPSP* |
| GOS2247_10471553 | 3300001959 | Marine | MLSNVDFPEPELPTINTNSPLLMEIETLSNALTLFSPSP* |
| KVRMV2_1000204662 | 3300002231 | Marine Sediment | MLSNVDFPEPELPTIKTNSPCSIESDTLSRAFTLFSPSP* |
| KVRMV2_1007136272 | 3300002231 | Marine Sediment | KRPIMFNRVDLPEPEAPTIRTISPFLIENEASCRARTRVSPVP* |
| FJ528644_1000002649 | 3300002516 | Orange Tunicate | MLSKVDFPEPELPTIRTISPCSTDKVALSSAFTLFSSSP* |
| JGI26060J43896_100035944 | 3300002913 | Marine | MLSNVDFPEPELPTIRTTSPCSIENVTLSSAFTLLIPSP* |
| JGI26060J43896_100266262 | 3300002913 | Marine | MFSSVDFPEPELPTIKTTSPCSIEKDTSSRAFTLLSPSP* |
| JGI26060J43896_101116602 | 3300002913 | Marine | MFSNVDFPEPELPTIKTTSPCSIEKDTSSRAFTSLSPIP* |
| JGI26060J43896_101351792 | 3300002913 | Marine | MFNNVDFPEPELPIIKTTSPCSIEKDTSSRALTLLSPSP* |
| JGI26061J44794_10128513 | 3300002919 | Marine | MLSNVDLPEPELPTIRTISPRSIESDTLSRAFIFNSPSP* |
| JGI26063J44948_10444022 | 3300002965 | Marine | MFNNVDFPEPELPTIKTTSPCSIEKDTSSRALTLLSPSP* |
| Ga0052264_10206924 | 3300003098 | Marine | MFSNVDFPEPDAPTIKTTSPCSIEKDTSSRAFTLLSPSP* |
| Pfc106_100003321 | 3300003254 | Marine Sponge Petrosia Ficiformis Associated | MLSNVDFPEPELPTIKTISPCSTERVALSRALTLFSPSP* |
| KH04A_12657642 | 3300003455 | Marine Sediment | MFSNVDLPEPELPTINTISPCLIEKDTLSSALTLLSPSP* |
| JGI26250J51715_10528361 | 3300003591 | Marine | IMLSSVDFPEPELPTIKTISPCSIESDTSSRAFTWLSPSP* |
| JGI26263J51726_10020723 | 3300003595 | Marine | MLSSVDFPEPELPTIKTISPCSIESDTSSRAFTWLSPSP* |
| Ga0051980_100050254 | 3300003830 | Groundwater | MLSSVDLPEPELPTIKTNSPCLIENEILSRALTLLSPCP* |
| Ga0055582_10077923 | 3300003847 | Pelagic Marine | MFSNVDFPEPELPTIKTISPCSIEKDALSRALTLLSPSP* |
| Ga0063241_10104584 | 3300003894 | Marine | MLSNVDFPEPELPTIRTISPCSTDKVASSRALTLFSPSP* |
| Ga0063391_100081213 | 3300003937 | Marine | MLSNVDFPEPELPTIRTTSPCSIEKVTLSSAFTLLIPSP* |
| Ga0055461_100580262 | 3300003991 | Natural And Restored Wetlands | MLSSVDLPEPELPTIKTNSPCLIEKDTLSSALTWLSPSP* |
| Ga0055439_100188072 | 3300004019 | Natural And Restored Wetlands | MFNKVDFPEPELPTINTNSPFSIENETLSNALTLFSPVP* |
| Ga0065180_100444622 | 3300004106 | Groundwater | MLSSVDLPEPELPTTKTNSPCLIENETLSRALTLLSPCP* |
| Ga0066642_101322151 | 3300004185 | Groundwater | MLSSVDLPEPELPTIKTNSPCLIENETLSRALTLLSPCP* |
| Ga0065726_1025537 | 3300004369 | Saline | MLSNVDLPDPELPTIRTTSPCSIESDTLSRAFTLLSPSP* |
| Ga0068996_101237782 | 3300005218 | Natural And Restored Wetlands | MLSKVDLPEPELPTINTNSPFSIENETLSNAFTLFSPVP* |
| Ga0073579_16789542 | 3300005239 | Marine | MFSNVDFPEPELPTIKTTSPCSIEKDTSSRAFTLLSPSP* |
| Ga0066860_100037989 | 3300005399 | Marine | MFSNVDFPEPELPTIKTTSPCSIEKDTLSSAFTLFSPSP* |
| Ga0070728_102540072 | 3300005588 | Marine Sediment | MFSNVDLPEPELPTIKTNSPSLIENEALSRALTLLSP* |
| Ga0070726_101492792 | 3300005600 | Marine Sediment | MFNNVDLPEPELPTIKTNSPSLIENEALSRALTLLSP* |
| Ga0070723_100779201 | 3300005612 | Marine Sediment | NVDLPEPELPTIKTNSPSLIENEALSRALTLLSP* |
| Ga0078430_1002865 | 3300005783 | Sediment | MFSNVDLPEPELPTIKTTSPCSIESDTLSRAFTLFSPSP* |
| Ga0078432_1028202 | 3300005785 | Sediment | MLSNVDLPEPELPTIKTTSPCSIESDTLSRAFTLFSPSP* |
| Ga0074474_161903225 | 3300005824 | Sediment (Intertidal) | MLSSVDLPEPELPTIKTNSPCLIENDTLSRALTLLSPSP* |
| Ga0074475_103829253 | 3300005828 | Sediment (Intertidal) | MLSNVDFPEPELPTIKTNSPFLIENETLSRALTLFSS* |
| Ga0074473_101935714 | 3300005830 | Sediment (Intertidal) | MLSKVDFPEPELPTINTNSPFSIENDTSSSAFTVFSPTP* |
| Ga0074470_1073311613 | 3300005836 | Sediment (Intertidal) | MLSNVDFPEPELPTINTNSPFSIENDTLSNAVTLFSPSP* |
| Ga0008649_101670882 | 3300005838 | Marine | NPIMFSNVDLPEPELPTIKTISPCSIENDTSSRAFT* |
| Ga0068482_19305802 | 3300006338 | Marine | FSKVDFPEPELPITNTNSPFFIENETLSSALTSVSASP* |
| Ga0099972_131093482 | 3300006467 | Marine | MFSNVDLPEPELPTINTISPCLIENETSSRAFTLLSASP* |
| Ga0082251_1000000424 | 3300006468 | Sediment | LSNVDLPEPELPTIKTTSPCSIDNDTLSRALTLLSPSP* |
| Ga0082251_100243103 | 3300006468 | Sediment | MFRSVDFPDPELPTINTNSPFSIENEALSNALTWFSPSP* |
| Ga0068489_1512812 | 3300006841 | Marine | VDFPEPELPTINTNSPFLIENETLSSAVTLVSASP* |
| Ga0075475_101392682 | 3300006874 | Aqueous | SNPIMFNRVDFPEPELPTIKANSPSSTEKDTLSNALTAFSPSP* |
| Ga0104999_10757183 | 3300007504 | Water Column | MLSKVDFPEPELPTIKTTSPCSIEKETSSSAFTWLSPSP* |
| Ga0102946_10002415 | 3300007614 | Soil | MLSNVDFPEPELPTIRTISPFSIENDTSSRALTLLSPSP* |
| Ga0102947_12153402 | 3300007619 | Soil | MLSKVDFPEPELPTMSTNSPFSIENETLSSAFTLFSPSP* |
| Ga0105010_10515101 | 3300007765 | Marine | KVDFPEPELPTIKTTSPCSIEKETSSSAFTWLSPSP* |
| Ga0105349_104391112 | 3300008253 | Methane Seep Mesocosm | MLSNVDFPEPELPTIKTTSPCSIEKDTSSRAFTSLSPSP* |
| Ga0115336_1175252 | 3300008464 | Sediment | MLSNVDLPEPELPTIKTTSPCSIESDTLSRALTLFSPSP* |
| Ga0114950_101243852 | 3300009030 | Deep Subsurface | MLRSVDLPEPELPTIKTTSPCSIENDTLSRALTLFSPSP* |
| Ga0114950_102806661 | 3300009030 | Deep Subsurface | MLRSVDLPEPELPTIKIISPLVIENDTLSRALTLFSPSP* |
| Ga0114950_103543121 | 3300009030 | Deep Subsurface | MLSNVDLPEPELPTIRTISPSSIESDTLSRAFTFNSPSP* |
| Ga0114948_100916452 | 3300009102 | Deep Subsurface | MLSNVDLPEPELPTTKITSPCSIENDTLSRAFTLFFPFP* |
| Ga0114948_103088213 | 3300009102 | Deep Subsurface | MLSNVDLPEPELPTIKTISPCSIENDTLSRAFTLFSPSP* |
| Ga0114996_100610821 | 3300009173 | Marine | IMLSNVDFPEPELPTIRTTSPCAIENVTLSSAFTLLIPSP* |
| Ga0115555_13851662 | 3300009476 | Pelagic Marine | DFPEPEPPTIKTT*PRSIEKDTSSRALTLLSPSP* |
| Ga0129284_100164543 | 3300009514 | Beach Aquifer Porewater | MLSNVDFPEPELPTIKTTSPCSIESDTLSRAFTLFSPSP* |
| Ga0129286_100154443 | 3300009515 | Sediment | MLSSVDLPEPELPTMRTISPCSIENETLSSALILLSPSP* |
| Ga0129286_102528092 | 3300009515 | Sediment | MLSSVDLPDPELPTMRTISPCSIENETSSSALTLLSPSP* |
| Ga0114931_1000598816 | 3300009702 | Deep Subsurface | MFRSVDFPEPELPTIRTNSPLLIENDTLSRAFTLLAPSP* |
| Ga0114931_100270156 | 3300009702 | Deep Subsurface | MLSNVDLPEPELPTIRTMSPFSIENETLSRALTLFSPSP* |
| Ga0114931_101492112 | 3300009702 | Deep Subsurface | MLSNVDLPEPELPTMRTISSLSIENETLSRAFTLFSPSP* |
| Ga0115002_102477992 | 3300009706 | Marine | MLSNVDFPEPELPTIRTTSPCAIENVTLSSAFTLLIPSP* |
| Ga0105164_101825311 | 3300009777 | Wastewater | SNSPIMLSRVDFPEPELPTINTNSPFSIENETLSNAFTLFSSVP* |
| Ga0105080_10370432 | 3300009797 | Groundwater Sand | MLSNVDFPEPELPTINTNSPFSIENETLSNAFILFSSAP* |
| Ga0105079_10254152 | 3300009805 | Groundwater Sand | MLSNVDFPEPELPTINTNSPFSIENETLSNAFTLFSSAP* |
| Ga0136261_10518873 | 3300010234 | Freshwater | MFSNVDLPEPELPTIKTNSPSLIENDALSRALTWLSPWP* |
| Ga0136847_116357973 | 3300010391 | Freshwater Sediment | MLSRVDFPEPELPTINTNSPFSIENETLSNAFTLFSSAP* |
| Ga0118731_1091248433 | 3300010392 | Marine | MLSNVDFPEPELPTIKTISPCSIENDALSSAFTLLSPSP* |
| Ga0118733_1006457192 | 3300010430 | Marine Sediment | MFSNVDLPEPELPMINTISPCLTENETSSRAFTLLSASP* |
| Ga0139250_11101743 | 3300010968 | Hydrothermal Chimney Microbial Mat | MLSKVDFPEPELPTISTISPCSIEKDALSRAFTLLSPSP* |
| Ga0139246_10374372 | 3300010969 | Hydrothermal Chimney Microbial Mat | NPIMFRSVDFPEPELPTIRTNSPLLIENDTLSRAFTLLAPSP* |
| Ga0114934_100052878 | 3300011013 | Deep Subsurface | MLSKVDFPDPELPTIKTISPCCIENDTSSRAFTLLSSSP* |
| Ga0114934_101942583 | 3300011013 | Deep Subsurface | MLSNVDFPEPELPTIKTTSPRSIEIDTSSRAFTLFSPSP* |
| Ga0114947_104118192 | 3300011112 | Deep Subsurface | MLSNVDLPEPELPTTKTTSPCSIENDTLSRAFTLFSPSP* |
| Ga0137318_10001642 | 3300012671 | Soil | MLSKVDFPEPELPTINTNSPFSIENETLSNAFTLFSSVP* |
| Ga0172420_100851333 | 3300013233 | Marine | MLSNVDLPEPELPTMRTISPLSIENETLSRAFTLFSPSP* |
| Ga0075302_11553582 | 3300014269 | Natural And Restored Wetlands | MLSSVDFPEPELPTINTNSPFSIENETLSNALTLFSPVP* |
| Ga0181607_106962502 | 3300017950 | Salt Marsh | PIMFNNVDLPEPELPTIKTNSPSLIENETLSKALT |
| Ga0212167_10827412 | 3300020230 | Sediment | MLSNVDLPEPELPTTKTTSPCSIENDTLSRAFTLFSPSP |
| Ga0212167_12586152 | 3300020230 | Sediment | MLRSVDLPEPELPTIKTTSPCSIENDTLSRALTLFSPSP |
| Ga0212168_10668703 | 3300020231 | Sediment | MLSNVDLPEPELPTIRTISPSSIESDTLSRAFTFNSPSP |
| Ga0212168_13962302 | 3300020231 | Sediment | MLSNVDLPEPELPTTNTTSPCSIENETLSRALTLFFPSP |
| Ga0212168_14169082 | 3300020231 | Sediment | MLSNVDLPEPELPTIKTISPCSIENDTLSRAFTLFSPSP |
| Ga0211662_100003733 | 3300020300 | Marine | MLSNVDFPEPELPTIRTTSPCSIEKVTLSSAFTLLIPSP |
| Ga0211623_100494592 | 3300020399 | Marine | MLSNVDFPEPELPTIRTTSPCSIENVTLSSAFTLLIPSP |
| Ga0206678_102749162 | 3300021084 | Seawater | MLSNVDFPEPELPTIKTTSPCSIEKDTSSRAFTWLSPSP |
| Ga0206679_103808912 | 3300021089 | Seawater | MLSKVDLPDPELPTIRTNSPCSIENETLSNAFTKLSPSP |
| Ga0222718_102192352 | 3300021958 | Estuarine Water | MFSNVDLPEPELPTIKTNSPSLIENEASSRALTWLSP |
| Ga0222718_103371092 | 3300021958 | Estuarine Water | MFSNVDLPEPELPTIKTNSPSLIENDALSRALTLLSPWP |
| Ga0224498_100264011 | 3300022202 | Sediment | SNVDFPEPELPTIKTISPCSIENDALSSALTLLSPSP |
| Ga0224497_100012797 | 3300022209 | Sediment | MLSNVDFPEPELPTIKTISPCSIENDALSSALTLLSPSP |
| Ga0224513_101280212 | 3300022220 | Sediment | IMLSNVDFPEPELPTIKTISPCSIENDALSRALTLLSPSP |
| Ga0224508_105597322 | 3300022413 | Sediment | MFSNVDFPEPELPTIKTISPCSIEKDALSRALTLLSPSP |
| (restricted) Ga0233428_1000094161 | 3300022888 | Seawater | MLSSVDFPEPELPTIKTISPCSIESDTSSRAFTWLSPSP |
| Ga0228655_10867561 | 3300024236 | Seawater | IILSNVDFPEPELPTIKTTSPCSIEKDTSSRAFTSLSPSP |
| Ga0209992_100218972 | 3300024344 | Deep Subsurface | MLSKVDFPDPELPTIKTISPCCIENDTSSRAFTLLSSSP |
| (restricted) Ga0255056_100105523 | 3300024521 | Seawater | MFRSVDFPDPELPTINTNSPFSIENEALSNALTWFSPSP |
| Ga0210005_10978171 | 3300025005 | Groundwater | MLSSVDLPEPELPTTKTNSPCLIENETLSRALTLLSPCP |
| Ga0210038_10400012 | 3300025007 | Groundwater | MLSSVDLPEPELPTIKTNSPCLIENETLSRALTLLSPCP |
| Ga0210057_10644453 | 3300025150 | Groundwater | MLSSVDLPEPELPTIKTNSPCLIENEILSRALTLLSPCP |
| Ga0208335_10068212 | 3300025243 | Deep Ocean | MLSNVDLPEPELPTIRTISPRSIESDTLSRAFIFNSPSP |
| Ga0209662_10361881 | 3300025596 | Marine | PIMLSSVDFPEPELPTIKTISPCSIESDTSSRAFTWLSPSP |
| Ga0209306_10771301 | 3300025680 | Pelagic Marine | VDFPEPELPTIKTTSPLSIEKDTLSRALTSLSPSP |
| Ga0209660_12211702 | 3300025722 | Marine | SVDFPEPEPPTIKTTXPRSIEKDTSSRALTLLSPSP |
| Ga0209308_102086942 | 3300025869 | Pelagic Marine | MFSNVDFPEPDAPTIKTTSPCSIEKDTSSRAFTLLSPSP |
| Ga0209456_103484262 | 3300025883 | Pelagic Marine | MFSNVDFPEPELPTIKTNSPCLIDNDTSSRALTILSS |
| Ga0210117_10232152 | 3300025985 | Natural And Restored Wetlands | MLSKVDLPEPELPTINTNSPFSIENETLSNAFTLFSPVP |
| Ga0208391_100001526 | 3300026108 | Marine | MFSNVDFPEPELPTIKTTSPCSIEKDTLSSAFTLFSPSP |
| Ga0209954_10028164 | 3300026144 | Soil | MLSNVDFPEPELPTIRTISPFSIENDTSSRALTLLSPSP |
| Ga0228622_10641811 | 3300026479 | Seawater | KSPIIFNSVDFPEPEPPTIKTTXPRSIEKDTSSRALTVLSPSP |
| Ga0208021_10158732 | 3300027191 | Estuarine | MLSNVDLPEPELPTIKTTSPCSIENDTSSRALTLLSPSP |
| Ga0208971_11464031 | 3300027582 | Marine | NNVDFPEPELPTIKTTSPLSIEKDTLSRALTLLSPSP |
| Ga0209816_11241962 | 3300027704 | Marine | MFNNVDFPEPELPTIKTTSPCSIEKDTSSRAFTLLSPSP |
| Ga0209379_100626572 | 3300027758 | Marine Sediment | MFSNVDLPEPELPTIKTNSPSLIENEALSRALTLLSP |
| Ga0209709_100045982 | 3300027779 | Marine | MFNNVDFPEPELPIIKTTSPCSIEKDTSSRALTLLSPSP |
| Ga0209035_100821742 | 3300027827 | Marine | MFSSVDFPEPELPTIKTTSPCSIEKDTSSRAFTLLSPSP |
| Ga0209035_100958832 | 3300027827 | Marine | MFSNVDFPEPELPTIKTTSPCSIEKDTSSRAFTLLSPSP |
| Ga0209035_102076002 | 3300027827 | Marine | MFSNVDFPEPELPTIKTTSPCSIEKDTSSRAFTSLSPIP |
| Ga0209271_100931882 | 3300027845 | Marine Sediment | MFNNVDLPEPELPTIKTNSPSLIENEALSRALTLLSP |
| Ga0209165_100181902 | 3300027978 | Marine Sediment | MFSNVDLPEPELPTIKTNSPSLIENEALSRVLTLLSP |
| Ga0265306_101583512 | 3300028598 | Sediment | MFSNVDFPEPELPTIKTISPCSIEKDALLRALTLLSPSP |
| Ga0265309_110975291 | 3300028599 | Sediment | IILSKVDFPEPELPTIKTISPCSIEKDALSSALTLLSPSP |
| Ga0265303_112662841 | 3300028600 | Sediment | MLSNVDFPEPELPTIKTISPCSIEKDALSRALTLLSPSP |
| Ga0302137_12958952 | 3300031588 | Marine | FVGPSKSPIMFNNVDFPEPELPIIKTTSPCSIEKDTSSRALTLLSPSP |
| Ga0302123_101511041 | 3300031623 | Marine | FNNVDFPEPELPIIKTTSPCSIEKDTSSRALTLLSPSP |
| Ga0307985_101826872 | 3300031629 | Marine | VDFPEPELPTIKTTSPCSIEKDTSSRAFTLLSPSP |
| Ga0315326_104837872 | 3300031775 | Seawater | MLSNVDFPEPELPTIKTTSPCSIEKDTSSRAFTSLSPSP |
| Ga0310121_107281682 | 3300031801 | Marine | VGPSKSPIMFNNVDFPEPELPIIKTTSPCSIEKDTSSRALTLLSPSP |
| Ga0310124_104964901 | 3300031804 | Marine | PSKSPIMFNNVDFPEPELPIIKTTSPCSIEKDTSSRALTLLSPSP |
| Ga0315316_100722264 | 3300032011 | Seawater | FNNVDFPEPELPTIKTTSPLSIEKDTSSRALTSLSPSP |
| ⦗Top⦘ |