NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049399

Metagenome / Metatranscriptome Family F049399

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049399
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 80 residues
Representative Sequence VLSFSEIPAEFAEFVQAKQKELAFNMLSSSAAGVLLANLAALVAGDASVELLVQTSQAQIPLLILTLIASVLSGKVENKPW
Number of Associated Samples 93
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 83.45 %
% of genes near scaffold ends (potentially truncated) 23.97 %
% of genes from short scaffolds (< 2000 bps) 94.52 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (78.767 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(45.890 % of family members)
Environment Ontology (ENVO) Unclassified
(90.411 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(64.384 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 58.72%    β-sheet: 0.00%    Coil/Unstructured: 41.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF00462Glutaredoxin 43.84



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.77 %
UnclassifiedrootN/A21.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10182114All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1005Open in IMG/M
3300009436|Ga0115008_10093793All Organisms → cellular organisms → Eukaryota2240Open in IMG/M
3300009507|Ga0115572_10272089All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi965Open in IMG/M
3300009543|Ga0115099_10789325All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina660Open in IMG/M
3300009544|Ga0115006_10446109All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina1133Open in IMG/M
3300009592|Ga0115101_1369535All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina682Open in IMG/M
3300009592|Ga0115101_1537419All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina582Open in IMG/M
3300009592|Ga0115101_1844925All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi980Open in IMG/M
3300009606|Ga0115102_10105369All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina530Open in IMG/M
3300009608|Ga0115100_10401988All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina620Open in IMG/M
3300009608|Ga0115100_10679407Not Available759Open in IMG/M
3300009608|Ga0115100_10963126All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1174Open in IMG/M
3300009608|Ga0115100_10998612All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi799Open in IMG/M
3300009608|Ga0115100_11137099All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina859Open in IMG/M
3300009679|Ga0115105_10869077All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina603Open in IMG/M
3300009790|Ga0115012_11190253All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi640Open in IMG/M
3300012919|Ga0160422_10688065Not Available652Open in IMG/M
3300012919|Ga0160422_11142631All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi506Open in IMG/M
3300012954|Ga0163111_11347971All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina701Open in IMG/M
3300013010|Ga0129327_10737029All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina555Open in IMG/M
3300017087|Ga0186551_106350All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1123Open in IMG/M
3300017089|Ga0186105_109741All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1105Open in IMG/M
3300017146|Ga0186209_113040All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1045Open in IMG/M
3300017150|Ga0186215_114131All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi979Open in IMG/M
3300017261|Ga0186463_103563All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1500Open in IMG/M
3300017315|Ga0186390_108978All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1315Open in IMG/M
3300017352|Ga0186452_1012442All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1126Open in IMG/M
3300018564|Ga0193513_1001512All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi577Open in IMG/M
3300018599|Ga0188834_1028605All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina563Open in IMG/M
3300018674|Ga0193166_1030562Not Available522Open in IMG/M
3300018711|Ga0193069_1042930Not Available548Open in IMG/M
3300018724|Ga0193391_1026244All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi709Open in IMG/M
3300018732|Ga0193381_1009122All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1247Open in IMG/M
3300018732|Ga0193381_1031763All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi733Open in IMG/M
3300018734|Ga0193290_1030997All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina621Open in IMG/M
3300018786|Ga0192911_1006373All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1281Open in IMG/M
3300018787|Ga0193124_1012392All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1044Open in IMG/M
3300018787|Ga0193124_1068677All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina534Open in IMG/M
3300018806|Ga0192898_1070386All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina599Open in IMG/M
3300018810|Ga0193422_1039147All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi837Open in IMG/M
3300018823|Ga0193053_1005688All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1685Open in IMG/M
3300018825|Ga0193048_1011178All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1234Open in IMG/M
3300018825|Ga0193048_1019793All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi977Open in IMG/M
3300018831|Ga0192949_1024213All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1224Open in IMG/M
3300018831|Ga0192949_1028737All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1131Open in IMG/M
3300018831|Ga0192949_1029691All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1114Open in IMG/M
3300018831|Ga0192949_1053953All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina814Open in IMG/M
3300018831|Ga0192949_1070611Not Available690Open in IMG/M
3300018864|Ga0193421_1045978All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi908Open in IMG/M
3300018870|Ga0193533_1034609All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1110Open in IMG/M
3300018870|Ga0193533_1058452All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi847Open in IMG/M
3300018922|Ga0193420_10046963All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi801Open in IMG/M
3300018927|Ga0193083_10076842All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina516Open in IMG/M
3300018942|Ga0193426_10029311All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1101Open in IMG/M
3300018955|Ga0193379_10058131All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1074Open in IMG/M
3300018955|Ga0193379_10075860All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi948Open in IMG/M
3300018955|Ga0193379_10142204All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina676Open in IMG/M
3300018979|Ga0193540_10185426All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina577Open in IMG/M
3300018980|Ga0192961_10176013All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina648Open in IMG/M
3300019003|Ga0193033_10055891All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1144Open in IMG/M
3300019003|Ga0193033_10228139All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina511Open in IMG/M
3300019009|Ga0192880_10056490All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi990Open in IMG/M
3300019009|Ga0192880_10168072Not Available546Open in IMG/M
3300019027|Ga0192909_10075529All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi809Open in IMG/M
3300019027|Ga0192909_10079506All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi798Open in IMG/M
3300019027|Ga0192909_10080511All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina795Open in IMG/M
3300019027|Ga0192909_10248761All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina547Open in IMG/M
3300019031|Ga0193516_10279586Not Available538Open in IMG/M
3300019032|Ga0192869_10250176Not Available767Open in IMG/M
3300019032|Ga0192869_10390353All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina606Open in IMG/M
3300019032|Ga0192869_10526235All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina502Open in IMG/M
3300019047|Ga0193549_10037247All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina622Open in IMG/M
3300019049|Ga0193082_10636244All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina601Open in IMG/M
3300019049|Ga0193082_10722254All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina562Open in IMG/M
3300019051|Ga0192826_10237296All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina672Open in IMG/M
3300019051|Ga0192826_10373029All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina515Open in IMG/M
3300019150|Ga0194244_10033661All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina769Open in IMG/M
3300019150|Ga0194244_10064550All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina633Open in IMG/M
3300019150|Ga0194244_10111297All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina526Open in IMG/M
3300020410|Ga0211699_10386874Not Available552Open in IMG/M
3300021878|Ga0063121_1041959All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi735Open in IMG/M
3300021902|Ga0063086_1011342All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1195Open in IMG/M
3300021934|Ga0063139_1074436All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi781Open in IMG/M
3300021935|Ga0063138_1107360All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina709Open in IMG/M
3300021935|Ga0063138_1159931All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina552Open in IMG/M
3300021954|Ga0063755_1120383Not Available728Open in IMG/M
3300028134|Ga0256411_1215320All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina602Open in IMG/M
3300030671|Ga0307403_10486835Not Available666Open in IMG/M
3300031710|Ga0307386_10112340All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1213Open in IMG/M
3300031785|Ga0310343_10130793All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1651Open in IMG/M
3300032463|Ga0314684_10114557All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1373Open in IMG/M
3300032463|Ga0314684_10128093All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1321Open in IMG/M
3300032463|Ga0314684_10152068All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1240Open in IMG/M
3300032463|Ga0314684_10161435All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1212Open in IMG/M
3300032463|Ga0314684_10167196All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1196Open in IMG/M
3300032463|Ga0314684_10186176All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1146Open in IMG/M
3300032463|Ga0314684_10186590All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1145Open in IMG/M
3300032463|Ga0314684_10212096All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1086Open in IMG/M
3300032463|Ga0314684_10258345All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi997Open in IMG/M
3300032463|Ga0314684_10746170Not Available560Open in IMG/M
3300032470|Ga0314670_10116379All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1237Open in IMG/M
3300032470|Ga0314670_10122498All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1215Open in IMG/M
3300032481|Ga0314668_10469098All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina646Open in IMG/M
3300032491|Ga0314675_10114584All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1237Open in IMG/M
3300032491|Ga0314675_10126642All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1189Open in IMG/M
3300032492|Ga0314679_10077749All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1388Open in IMG/M
3300032517|Ga0314688_10207452All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1004Open in IMG/M
3300032517|Ga0314688_10532033Not Available638Open in IMG/M
3300032518|Ga0314689_10309950All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi829Open in IMG/M
3300032518|Ga0314689_10578517Not Available583Open in IMG/M
3300032519|Ga0314676_10202312All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1119Open in IMG/M
3300032520|Ga0314667_10349317All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina816Open in IMG/M
3300032520|Ga0314667_10788805All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina513Open in IMG/M
3300032540|Ga0314682_10423630All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi734Open in IMG/M
3300032615|Ga0314674_10585493Not Available571Open in IMG/M
3300032615|Ga0314674_10637603All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina542Open in IMG/M
3300032616|Ga0314671_10386386All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi764Open in IMG/M
3300032617|Ga0314683_10207534All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1195Open in IMG/M
3300032617|Ga0314683_10303511All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi993Open in IMG/M
3300032650|Ga0314673_10423197All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina685Open in IMG/M
3300032666|Ga0314678_10522367Not Available533Open in IMG/M
3300032708|Ga0314669_10703290Not Available554Open in IMG/M
3300032709|Ga0314672_1192951All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi764Open in IMG/M
3300032711|Ga0314681_10780970All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina523Open in IMG/M
3300032713|Ga0314690_10527969All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina583Open in IMG/M
3300032724|Ga0314695_1371711Not Available543Open in IMG/M
3300032725|Ga0314702_1297578Not Available616Open in IMG/M
3300032725|Ga0314702_1335135Not Available574Open in IMG/M
3300032725|Ga0314702_1369940All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina540Open in IMG/M
3300032727|Ga0314693_10141498All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1175Open in IMG/M
3300032727|Ga0314693_10630703Not Available580Open in IMG/M
3300032727|Ga0314693_10670739Not Available559Open in IMG/M
3300032727|Ga0314693_10705902All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina542Open in IMG/M
3300032728|Ga0314696_10506326All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina621Open in IMG/M
3300032734|Ga0314706_10111123All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1219Open in IMG/M
3300032742|Ga0314710_10497228All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina503Open in IMG/M
3300032745|Ga0314704_10424801All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Prymnesiaceae → Haptolina → Haptolina ericina735Open in IMG/M
3300032754|Ga0314692_10292998Not Available880Open in IMG/M
3300032755|Ga0314709_10583942Not Available678Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine45.89%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater34.25%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine9.59%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated4.79%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater1.37%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.37%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.68%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.68%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.68%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300012919Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017087Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium with seawater w/o silicate, 18 C, 20 psu salinity and 133 ?mol photons light - Emiliania huxleyi 379 (MMETSP0996)Host-AssociatedOpen in IMG/M
3300017089Metatranscriptome of marine eukaryotic communities from unknown location in L/25 medium, at 18 C, 32 psu salinity and 473 ?mol photons light - Gephyrocapsa oceanica RCC 1303 (MMETSP1364)Host-AssociatedOpen in IMG/M
3300017146Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 752 ?mol photons light - Emiliania huxleyi CCMP 370 (MMETSP1157)Host-AssociatedOpen in IMG/M
3300017150Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 566 ?mol photons light - Emiliania huxleyi CCMP 370 (MMETSP1155)Host-AssociatedOpen in IMG/M
3300017261Metatranscriptome of marine eukaryotic communities from English Channel in enriched f/2 medium with filtered seawater, 15 C, 35 psu salinity and 328 ?mol photons light - Coccolithus braarudii PLY182g (MMETSP0164_2)Host-AssociatedOpen in IMG/M
3300017315Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in K/2 medium, 17 C, 35 psu salinity and 672 ?mol photons light - Scyphosphaera apsteinii RCC 1455 (MMETSP1333)Host-AssociatedOpen in IMG/M
3300017352Metatranscriptome of marine eukaryotic communities from English Channel in Marine Media, 18 C, 36 psu salinity and 462 ?mol photons light - Haptolina brevifila UTEX LB 985 (MMETSP1094)Host-AssociatedOpen in IMG/M
3300018564Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003083 (ERX1789499-ERR1719165)EnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018724Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002036 (ERX1789589-ERR1719194)EnvironmentalOpen in IMG/M
3300018732Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789574-ERR1719298)EnvironmentalOpen in IMG/M
3300018734Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001612 (ERX1789403-ERR1719254)EnvironmentalOpen in IMG/M
3300018786Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000682 (ERX1789372-ERR1719517)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018806Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000722 (ERX1789621-ERR1719484)EnvironmentalOpen in IMG/M
3300018810Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002291 (ERX1789538-ERR1719380)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018864Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789379-ERR1719364)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018955Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001972 (ERX1789369-ERR1719393)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300019003Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002825 (ERX1789479-ERR1719182)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019047Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX1399746-ERR1328125)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020410Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148)EnvironmentalOpen in IMG/M
3300021878Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI24538J26636_1015797013300002154MarineVGGRWNVGGVLSMSEIPAEFAEFAKQKQQQLVVNVLSSSAAGVVLANLAALVAGDASLAVLGQILQTQVPLIALTAVVSFLAAFVKR*
Ga0103951_1018211413300008832MarineVGSRWNIDGVLSFSEIPAEFAEFVKAKQQELAFNMLSSSASGVLLANLAALVAGDASVELLVQTSQAQIPLLILTLIASVLSGKVEEKSW*
Ga0115008_1009379333300009436MarineMSEIPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASLDLFAEIVQTQLPLIALTGAAAVLSGTEMARPPWAK*
Ga0115572_1027208923300009507Pelagic MarineVLSFSEIPSEFADFVKSKQQQLAFNMLSSSAAGVVLASLAALVAGDATVQLLVQLCQAQIPLLILTLIASILSGKVENKPW*
Ga0115099_1078932513300009543MarineVLSFSEIPAEFADFVKEKQQELAFNMLSSSAIGVVLANLAALVAGDASVELLIQTSQAQIPLLILTLIASILSGKVDKKPW*
Ga0115006_1007940113300009544MarineVGGRWNVGGVLSMSEIPAEFAEFAKQKQQQLVVNVLSSSAAGVVLANLAALVAGDASLAVLGQILQTQVPLIALTAVVSFLA
Ga0115006_1044610923300009544MarineVLSFSEIPAEFAEFVQAKQQELAFNMLSSSAAGVVLANFAALLAGDASVELLLQTSQAQIPLLILTLIASILSGKVEDKPW*
Ga0115101_136953513300009592MarineVLSFSEIPEEFADFVKSKQQQLAFNMLSSSAAGVVLASLAALVAGDATVQLLVQLCQAQIPLLILTLIASILSGKVENKPW*
Ga0115101_153741923300009592MarineVLSFSEIPAEFADFVKAKQQELAFNMLSSSLAGVVLANLAALVAGDASVEVLIQTSQAQIPLLILTLIASVLSGKVENKPW*
Ga0115101_184492523300009592MarineVLSFSEIPAEFAGFVEAKQKELAFNMLSSSAVGVVLANAAALVAGDASAELLLQTCQLQIPLLVLTLIASILSGKVENKPW*
Ga0115102_1010536913300009606MarinePAEFAEFVQAKQRELAFNMLSSSAVGVLLANLAALFAGDASVEVLIQTSQLQIPLLVLTLIAFVLSGKVENKPW*
Ga0115100_1040198813300009608MarineVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAAGVTVASLAALVAGDASTDLLVQLSQAQIPLLFLTLIASILSGKVENKPW*
Ga0115100_1067940723300009608MarineVLSFSEIPEEFADFVKQKQQQLAFNMLSSSAAGVVLASLAALVAGDATVQLLVQLCQAQIPLLILTLIASILSGKVENKPW*
Ga0115100_1096312623300009608MarineVKAKQRELAFNMLSSSAVGVVLANLAALVAGDASVELLVQTSQAQVPLLILTLIASVLSGKVENKPW*
Ga0115100_1099861223300009608MarineVLSFSEIPAEFAEFVQAKQQELAFNMLSSSAAGVVLANFAALLAGDASMELLLQTSQAQIPLLILT
Ga0115100_1113709913300009608MarineVLSFSEIPAEFAEFVRAKQRQLAFNMLSSSAVGVLVANLAALAAGDASVDVLAQTSQAQVPLLILTLVASILSGKVENKPW*
Ga0115100_1115816113300009608MarineMSEIPAELADFVQAKRKQLALNVVTSSAAGVLLANLAALFAGEASLAVLGQTLQAQVPLIVLTVAASVLAGLKR*
Ga0115105_1086907723300009679MarineVLSFSEIPAEFADFVKAKQQELLFNMLSSSAVGVLCANLAALAAGDASVELLVQTSQAQIPLLVLTLIASVLSGKVENKPW*
Ga0115012_1119025313300009790MarineVLSFSEIPAEFADFVQAKRRQLALNVLSSSAAGVFLANLAALVAGDASVAVLTSTVQTQVPLIALTAVASFLSGMVRK*
Ga0160422_1068806513300012919SeawaterVLSFSAIPPEFKEFVQAKQRQLAFNMLSSSAAGVLVANVAALIAGDASVELLVQTSQLQIPLLILTLIVSVLSGKVENKPW*
Ga0160422_1114263123300012919SeawaterVLSFSEIPAEFAGFVKAKQQELAFNMLSSSAAGVVLANFVALLAGDASMELLVQTCQLQIPLLVL
Ga0163111_1134797123300012954Surface SeawaterVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAAGVALASLAALVAGDASVELLLQLAQAQVPLLILTLIASILSGKVENKPW*
Ga0129327_1073702913300013010Freshwater To Marine Saline GradientVLSFSEIPAEFADFVKSKQKELAFNMLSSSAAGVLLANLAALVAGEASLDVLVQTSLLQLPLLVLTLIASVLSGKVDKKPW*
Ga0186551_10635023300017087Host-AssociatedMSETPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASLDLFAEIVQTQLPLIALTGAAAVLSGTEMARPPWAK
Ga0186105_10974113300017089Host-AssociatedVLSFSEIPAEFADFVAAKQRQLAFNMLSSSAVGVVCANLAALVAGDASVELLVQTSQAQIPLLVLTLIASILSGKVENKPW
Ga0186209_11304013300017146Host-AssociatedMSEIPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASLDLFAEIVQTQLPLIALTGAAEMARPPWAK
Ga0186215_11413113300017150Host-AssociatedMSEIPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASLDLFAEIVQTQLPLIALTGAAAVLSG
Ga0186463_10356313300017261Host-AssociatedVLSFSEIPAEFAGFVKAKQKELAFNMLSSSAVGVVFANIAALVAGDASVELLVQTCQLQIPLLILTLIASVLSGKVENKPW
Ga0186390_10897813300017315Host-AssociatedVLSFSEIPAEFAEFVKAKQQELAFNMLSSSAAGVVLANLAALVAGDASVELLIQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0186452_101244223300017352Host-AssociatedVLSFSKIPAEFVDFVKAKQQELAWNMLSSSAAGVLIANLAALIAGDASVELLVQTSQAQIPLLILTLVASILSGKVENKPW
Ga0193513_100151223300018564MarineVLSFSAIPPEFKEFVQAKQRQLAFNMLSSSAAGVLVANVAALIAGDASVELLVQTSQLQI
Ga0188834_102860513300018599Freshwater LakeDGVLSFSEIPAEFADFVQAKQQQLAFNMLSSSAAGVVLANLAALVAGDASVQLLVETSQLQIPLLLLTLIASVLSGKVENKPW
Ga0193166_103056213300018674MarineVLSFSEIPAEFAEFVKAKQQELAFNMLSSSAAGVVGANLAALAAGDASLELLVQISQAQVPLLVLTLIASVLSGKVDKKPW
Ga0193069_104293013300018711MarineEIPAEFAEFVHAKQRQLAFNMLSSSAAGVLGANLAALVAGDASFELLVTTCEAQIPLLILTLIASVLSGKVENKPW
Ga0193391_102624413300018724MarineVLSFSEIPAEFADFVQAKRRQLALNVLSSSAAGVFLANLAALVAGDASVAVLTSTVQTQVPLIALTAVASFLSGMVRK
Ga0193381_100912223300018732MarineVLSFSEIPPEFAEFVKAKQQQLAFNMLSSSAVGVLGAYLAALVAGDASVELLVQISEAQIPLLILTLIASVLSGKVDKKPW
Ga0193381_103176313300018732MarineVLSFSEIPAELADFVKAKQRELAFNMLSSSAVGVVLANLAALVAGDASVDLLIQTSQAQIPLLILTLIASILSGKVENKPW
Ga0193290_103099713300018734MarineVLSFSEIPAEFAGFVKAKQQQLLFNMLSSSAVGVLCANLVALAAGDASVELLVQTSEAQIPLLVLTLIASVLSGKVENKPW
Ga0192911_100637323300018786MarineVLSFSEIPEEFAEFVQAKQRQLAFNMLSSSAAGVLLANLAALAAGDFSLQLLAETSEAQIPLLILTLLASVLSGKVENKPW
Ga0193124_101239213300018787MarineVLSFSEIPAEFADFVKAKQRQLAFNMLSSSAVGVVLANLAALVAGEASVDVLVQTSQAQIPLLILTLVASVLSGSEKVAGLKPW
Ga0193124_106867713300018787MarineVLSFSEIPAEFASFVKAKQKELAFNMLSSSAAGVVLANLAALVAGDASLEVLVQTCQLQIPLLVLTLIASVLSGKVENKPW
Ga0192898_107038613300018806MarineVLSFSEIPPEFADFVKEKQQQLAFNMLSSSAVGVLGASLAALIAGDATVELLVQISEAQIPLLILTLIASVLSGKVDKKPW
Ga0193422_103914723300018810MarineVLSFSAIPPEFKEFVQAKQRQLAFNMLSSSAAGVLVANVAALIAGDASVELLVQTSQLQIPLLILTLIVSVLSGKVEN
Ga0193053_100568813300018823MarineVLSFSEIPAEFADFVQAKRRQLALNVLSSSAAGVLLANLAALVAGDASVAVLTSTVQTQVPLIALTAVASFLSGMVRK
Ga0193048_101117823300018825MarineVKTKQRELALNMLSSSAAGVLVANLAALVAGDASVEVLVQTSQAQIPLLILTLIASILSGKVEDKPW
Ga0193048_101979313300018825MarineMSEIPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASLDLFAEIVQTQLPLIALTGAAAVLSGTEMARPPWAK
Ga0192949_102421313300018831MarineVLSFSEIPAEFADFVQAKQRELALNMLSSSAAGVVLANLAALVAGDASMDLLAQTSLAQVPLLILTLIASVLSGKVDNKPW
Ga0192949_102873713300018831MarineVLSFSEIPEEFADFVKQKQQQLAFNMLSSSAAGVVLASLAALVAGDATVQLLVQLCQAQIPLLILTLIASILSGKVENKPW
Ga0192949_102969123300018831MarineVLSFSEIPAEFADFVQAKQRELAFNMLSSSAVGVVLANLAALVAGDASVELLVQTCQLQIPLLILTLIASVLSGKVENKPW
Ga0192949_105395323300018831MarineVLSFSEIPAEFADFVQAKQRQLAFNMVSSSAAGVVGANLAALVAGDASVEVLVQTSELQIPLLVLTLVASVLSGKVENKPW
Ga0192949_107061113300018831MarineVLSFSEIPAEFADFVAAKRKELAFNMLSSSAAGVVLANLAALVAGDASLEVLAQTAQLQIPLLILTLIASVLSGKVENKPW
Ga0193421_104597823300018864MarineVLSFSEIPAEFADFVQAKRRQLALNVLSSSAAGVFLANLAALVAGDASAAVLASTVQTQVPLIALT
Ga0193533_103460913300018870MarineVLSFSEIPPEFADFVKEKQQQLAFNMLSSSAVGVLGASLAALVAGDASVELLVQISQAQIPLLILTLIASVLSGKVDQKPW
Ga0193533_105845213300018870MarineVLSFSEIPPEFAEFVKAKQQQLAFNMLSSSAVGVLGASLAALIAGDATVELLVQISEAQIPLLILTLIASVLSGKVDKKPW
Ga0192977_103364213300018874MarineVGSRWNVDGVLSMSEIPAEFAEFVKTKQQQLAINVLSSSAAGVALANVAALIAGDTSLAVLGETIQAQLPLLVLTAIVSFGTSAVKR
Ga0193090_103901323300018899MarineVGSRWNVDGVLSMSEIPAEFAEFVKTKQQQLAINVLSSSAAGVALANVAALIAGDASLAVLGETIQAQLPLLVLTAIVSFGTSAVKR
Ga0193420_1004696313300018922MarineVLSFSAIPPEFKEFVQAKQRQLAFNMLSSSAAGVLVANVAALIAGDASVELLVQTSQLQIPLLILTLIVSVLSGKVENKP
Ga0193083_1007684213300018927MarineVLSFSEIPAELAEFVKAKQQELAFNMLSSSAAGVVLANLAALVAGDASMEVLIQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0193426_1002931113300018942MarineVLSFSEIPAEFAEFVHAKQRQLAFNMLSSSAAGVLGANLAALVAGDASFELLVTTCEAQIPLLILTLIASVLSGKVENKPW
Ga0193379_1005813123300018955MarineVLSFSEIPAEFADFVKAKQRQLAFNMLSSSAVGVVVANLAALVAGDASAAVLAQTSEAQIPLLILTLVASILSGKVENKPW
Ga0193379_1007586023300018955MarineVLSFSEIPAEFAEFVRAKQRELAFNMLSSSAAGVALASLAALLAGDASVELLVQLAQAQIPLLILTLIASILSGK
Ga0193379_1014220423300018955MarineVLSFSEIPDEFADFVQAKQRQLAFNMLSSSAAGVVVANLAALIAGDASLEVLMQTSQLQVPLLILTLIASILSGKVENKPW
Ga0193540_1018542613300018979MarineVLSFSEIPEEFAEFVQAKQRQLAFNMLSSSAAGVLLANLAALLAGDASAALLAETSQAQIPLLIFTLLASVLSGKVENKPW
Ga0192961_1017601313300018980MarineVLSFSEIPSEFADFVKSKQQQLAFNMLSSSAAGVVLASLAALVAGDATVQLLVQLCQAQIPLLILTLIASILSGKVENKPW
Ga0193033_1005589113300019003MarineVLSFSEIPPEFAEFVKAKQQQLAFNMLSSSAVGVLGASLAALVAGDASVELLVQISQAQIPLLILTLIASILSGKVDQKPW
Ga0193033_1022813923300019003MarineVLSFSEIPAEFAPFIKAKQQQLAFNMLSSSAAGVLCANLAALVAGDASVEVLVQTSELQIPLLILTLIVSVLSGKVENKPW
Ga0192880_1005649013300019009MarineVLSFSEIPAEFAEFVQAKQKELAFNMLSSSAAGVLLANLAALVAGDASVELLVQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0192880_1016807223300019009MarineGSRWNIDGVLSFSEIPAEFADFVRAKQQELAFNMLSSSLAGVLLANLAALVAGDASVELLAQVSQAQIPLLILTLIASVLSGKVEKKPW
Ga0192909_1007552913300019027MarineVLSFSEIPAEFADFVKSKQRQLAFNMLSSSAAGVVLANLAALVAGDASIEVLVQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0192909_1007950613300019027MarineMSEIPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASFDHFAEILQTQIPLIALTGAAAVLSGTEFARPPWAK
Ga0192909_1008051113300019027MarineVLSFSEIPAEFADFVRAKQKQLAFNMLSSSAVGVVLANLAALVAGDASVGLLIQTCQAQISLLILTLIASILSGKVENKPW
Ga0192909_1024876123300019027MarineVLSFSEIPAEFAEFVKAKQKELAFNMLSSSAVGVVLANLAAVAAGDASVELLIQTSQAQVPLLILTLIASVLSGKVDHKPW
Ga0193516_1027958623300019031MarineGCIAGSRWNIDGVLSFSEIPAEFADFVKAKQRELAFNMLSSSAVGVVLANLAALVAGDASIDLLVQTCQLQIPLLVLTLIASVLSGKVESKPW
Ga0192869_1025017623300019032MarineMDGVLSFSEIPAEFAEFVQAKQRQLAFNMLSSSAAGVLGANIVALAAGDASTDLLLTISEAQIPLLLITLIVSVLSGKVESKPW
Ga0192869_1039035313300019032MarineVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAAGVALASLAALVAGDASVELLVQLSQAQIPLLILTLIASILSGKVENKPW
Ga0192869_1052623513300019032MarineHGGSRRNIDGVLSFSKIPAEFADFVQAKQRELAFNMLSSSAAGVVLANLAALLAGDASVELLVQTSQAQIPLLILTLVASVLSGKVENKPW
Ga0193549_1003724713300019047MarineMSEIPAEFADFVQAKRKELAFNVLSSSAAGVLLANLAAAFAGDASFALFGQILQTQIPLIALTAVASVVSGMVKK
Ga0193082_1063624413300019049MarineVLSFSEIPPEFADFVKTKQQQLAFNMLSSSAVGVLGAYLAALVAGDASVELLVQMSEAQIPLLILTLIASVLSGKVDKKPW
Ga0193082_1072225413300019049MarineVLSFSEIPEEFAEFVQAKQRQLAFNMLSSSAAGVLLANLAALLAGDASAALLAETSQAQIPLLIFTLLSSVLSGKVENKPW
Ga0192826_1023729613300019051MarineVLSFSEIPAEFADFVKAKQRELAFNMLSSSAVGVVLANLAALVAGDASVNLLIEISQAQIPLLILTLIASVLSGMVEKKPW
Ga0192826_1037302913300019051MarineVLSFSEIPAEFADFVAAKRKELAFNMLSSSAVGVVLANLAALVAGDASLEVLTQTAQLQIPLLILTLIASILSGKVENKPW
Ga0194244_1003366113300019150MarineVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAAGVVLANLAALVAGDASEELLIQTSQAQIPLLTLTLIASVLSGKVENKPW
Ga0194244_1006455013300019150MarineVLSFSEIPAEFADFVRAKQQQLAFNMLSSSAAGVLIANLAALVAGDASVEVLVQTSQLQIPLLILTLIASILSGKVDNKPW
Ga0194244_1011129723300019150MarineVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAAGVLLANLAALVAGDASVELLAQTSQVQIPLLILTLIASVLSGKVENKPW
Ga0211699_1038687413300020410MarineVLSFSAIPPEFKEFVQAKQRQLAFNMLSSSAAGVLVANVAALIAGDASVELLVQTSQLQIPLLVLTLIVSVLSGKVENKPW
Ga0063121_104195923300021878MarineVLSFSEIPAEFADFVQAKQRQLAFNMLSSSAAGVLGANLAALVAGDASFELLVTTSEAQIPLLIITLIASVLSGKVENKPW
Ga0063086_101134223300021902MarineVLSFSEIPAEFAEFVQAKQQELAFNMLSSSAAGVVLANFAALLAGDASMELLLQTSQAQIPLLILTLIASILSGKVEDKPW
Ga0063139_107443623300021934MarineMSEIPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASLDLFAEIVQTQLPLIALTGAAAVLS
Ga0063138_110736023300021935MarineVLSFSEIPAEFAEFVRAKQRQLAFNMLSSSAAGVVLANLAALVAGDASVQLLAETSQAQIPLLVLTLIASVLSGKVENKPW
Ga0063138_115993123300021935MarineVLSFSEIPAEFAGFVKAKQQELAFNMLSSSAIGVVVANFAALIAGDASVELLVQTCQLQIPLLVLTLIASVLSGKVENK
Ga0063098_109953623300021942MarineVGGRWNVGGVLSMSEIPAEFAEFAKQKQQQLVVNVLSSSAAGVVLANLAALVAGDASLAVLGQILQTQVPLIALTAVVSFLAAFVKR
Ga0063755_112038323300021954MarineVLSFSEIPAEFAGFVKAKQKELAFNMLSSSAVGVVFANIAALVAGDASVELLVQTCQLQIPLLIFTLIASVLSGKVENKPW
Ga0256411_118024323300028134SeawaterMEKVPPEYAEFVEEKQLQLLLNVLSSSAAGVAIANAVALVSGDASTAVLMDTLQTQVPLLALTAVASVGTIVMKKA
Ga0256411_121532013300028134SeawaterVLSFSEIPAEFAGFVRAKQQELAFNMLSSSAVGVVLANLAALVAGDATVDLLIQVSQAQIPLLVLTLIASILSGMVENKPW
Ga0307403_1048683523300030671MarineMSEVPAEFADFVQAKRKELAFNMLSSSTAGVVLAKLAALVAGDASIGVPVQTCQLQIPLLFLTFVASVLSGKVDKKPW
Ga0307386_1011234023300031710MarineVLSFSEIPPEFAEFVKAKQQQLAFNMLSSSAVGVLGANLAALVAGDASVELLVQISEAQIPLLILTLVASVLSGKVDKKPW
Ga0310343_1013079323300031785SeawaterVLSFSAIPPEFKEFVQAKQRQLAFNMLSSSAAGVLVANVAALIAGDASVELLVQTSQLQIPLLILTLIVSVLSGKVENKPW
Ga0314684_1011455723300032463SeawaterVLSFSEIPAEFADFVRAKQRELAFNMLSSSAVGVLLANLAALIAGEASVEVLVQTSQLQLPLLVLTLVASILSGKVENKPW
Ga0314684_1012809323300032463SeawaterVLSFSEIPAEFADFVKAKQKELAFNMLSSSAVGVVLANVAALVAGDASVELLVQTCQLQVPLLVLTLIASVLSGKVENKPW
Ga0314684_1015206823300032463SeawaterVKTKQRELAFNMLSSSAVGVVLANLAALVAGDASVELLVQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0314684_1016143523300032463SeawaterVLSFSTIPAEFADFVAAKQRQLAFNMLSSSATGVVFANLAALVAGDASVELLVQTSQAQVPLLVLTLLASILSGKVENKPW
Ga0314684_1016719613300032463SeawaterVLSFSEIPAEFADFVKSKQRQLAFNMLSSSAVGVVLANLAALVAGDASVEVLLQTSQAQIPLLILTLIASVLSGKVDKKPW
Ga0314684_1018617623300032463SeawaterVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAAGVTLASLAALVAGDASVDLLVQLSQAQIPLLFLTLIASILSGKVENKPW
Ga0314684_1018659033300032463SeawaterVLSFSEVPAELAGFVRAKQRELALNMISSSAAGVLVANLAALAAGDASVDVLLRTSELQIPLLGLTLIVSVLSGKVENKPW
Ga0314684_1021209613300032463SeawaterVLSFSEIPAEFADFVAAKQRELAFNMLTSSAAGVVVANLAALVAGDATVEVLAQTSQAQLPLLVVTLIASVLSGKVENKPW
Ga0314684_1025834523300032463SeawaterVLSFSEIPAEFAGFVQEKQKQLAFNMLSSSAAGVVGANVAALVAGDASVQLLVETSQLQIPLLVLTLVASVLSGKVENKPW
Ga0314684_1074617013300032463SeawaterMSEIPPEFAAFVKAKQRQLALNVLSSAATGVVLANLAALVAGDFSLAVLGQTIQTQVPLMVLTAVASFLSGMVKK
Ga0314670_1011637913300032470SeawaterVKTKQRELAFNMLSSSAVGVVLANLVALVAGDASVELLVQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0314670_1012249823300032470SeawaterVLSFSEIPAEFAGFVQEKQKQLAFNMLSSSAAGVVGANLAALVAGDASVQLLVETSQLQIPLLVLTLVASVLSGKVENKPW
Ga0314668_1046909813300032481SeawaterVLSFSEIPAEFASFVEAKQKELAFNMLSSSAAGVVLANLAALVAGDASLEVLVQTCQLQILLLILTLIASILSGKVENKPW
Ga0314675_1011458413300032491SeawaterVREKQRELAFNMLSSSAAGVVLANLAALVAGDATMELLVQTCQLQIPLLVLTLIASVLSGKVESKPW
Ga0314675_1012664223300032491SeawaterVKAKQRELAFNMLSSSAVGVVLANLVALVAGDASVELLVQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0314679_1007774913300032492SeawaterVLSFSEIPAEFASFVEAKQKELAFNMLSSSAAGVVLANLAALVAGDASLEVLVQTCQLQIPLLILTLIASILSGKVENKPW
Ga0314688_1020745213300032517SeawaterVLSFSEIPAEFAGFVQEKQKQLAFNMLSSSAAGVVGANVAALVAGDASVQLLVETSQLQIPLLVLTLVASVLSGKVESKPW
Ga0314688_1053203313300032517SeawaterCIAGSRWNLDGVLSFSEIPAEFAGFVKAKQQELAFNMLSSSAVGVVVANLAALIAGDASVQLLVQTCQLQIPLLVLTLIASVLSGKVENKPW
Ga0314689_1030995013300032518SeawaterVLSFSEIPAEFAGFVQEKQKQLAFNMLSSSAAGVVGANLAALVAGDASVQLLVETSQLQIPLLVLTLVASVLSGKVESKPW
Ga0314689_1057851713300032518SeawaterAEFADFVRAKQRELAFNMLSSSAVGVLLANLAALIAGEASVEVLVQTSQLQLPLLVLTLVASILSGKVENKPW
Ga0314676_1020231213300032519SeawaterVKAKQRELAFNMLSSSAVGVVLANLAALVAGDASVELLVQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0314667_1034931723300032520SeawaterVLSFSEIPAEFASFVVAKQKELAFNMLSSSAAGVVLANLAALVAGDASLEVLVQTCQLQIPLLILTLIASILSGKVENKPW
Ga0314667_1078880513300032520SeawaterVLSFSEIPAEFAEFVKTKQRELAFNMLSSSAAGVLLANLAAFVAGDASVELLIQTSQAQIPLLILTLIASILSGKVENKPW
Ga0314682_1042363023300032540SeawaterVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAAGVTLASLAALVAGDASVDLLVQLSQAQIPLLFLTLIASILSGKVE
Ga0314674_1058549313300032615SeawaterSFSEIPAEFADFVRAKQRELAFNMLSSSAVGVLLANLAALIAGEASVEVLVQTSQLQLPLLVLTLVASILSGKVENKPW
Ga0314674_1063760313300032615SeawaterVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAEGVTLASLAALVAGDASVDLLVQLSQAQIPLLFLTLIASILSGKVENKPW
Ga0314671_1038638623300032616SeawaterVLSFSEIPAEFAGFVQEKQKQLAFNMLSSSAAGVVGANVAALVAGDASVQLLVETSQLQIPLLVLTLVASVLSGKV
Ga0314683_1020753413300032617SeawaterVLSFSEIPAEFAEFVQAKQQELAFNMLSSSAAGVVLASLAALVAGDATVQLVVQLCQAQIPLLILTLIASILSGKVEDKPW
Ga0314683_1030351123300032617SeawaterVLSFSEIPAEFAEFVQAKQRELAFNMLSSSAAGVTLASLAALVAGDASVDLLVQLSQAQIPLLFLTLIASILSGKVENK
Ga0314673_1042319713300032650SeawaterVLSFSEIPAEFADFVQAKQQQLAFNMLSSSAAGVVLANLAALVAGDASVQLLVETSQLQIPLLLLTLIASVLSGKVENKPW
Ga0314678_1052236713300032666SeawaterLSFSEVPDEFAGFVREKQRELAFNMLSSSAAGVVLANLAALVAGDATMELLVQTCQLQIPLLVLTLIASVLSGKVESKPW
Ga0314669_1070329013300032708SeawaterAGFVRAKQRELALNMISSSAAGVLVANLAALAAGDASVDVLLRTSELQIPLLGLTLIVSVLSGKVENKPW
Ga0314672_119295113300032709SeawaterVLSFSEIPAEFADFVKAKQRQLAFNMLSSSAVGVVLANLAALVAGDATAELLIQTSQAQIPLLILTLIASVLSGKVENK
Ga0314681_1078097013300032711SeawaterVLSFSEIPEEFAEFVRAKQQQLAFNMLSSSAAGVVLASLAALVAGDATVQLLVQLCQAQIPLLILTLIASILSGKVENKPW
Ga0314690_1052796913300032713SeawaterIAGSRWNLDGVLSFSEIPAEFAEFVKTKQRELAFNMLSSSAVGVVLANLVALVAGDASVELLVQTSQAQIPLLILTLIASVLSGKVENKPW
Ga0314695_137171113300032724SeawaterCIAGSRWNIDGVLSFSEIPAEFADFVRAKQRELAFNMLSSSAVGVLLANLAALIAGEASVEVLVQTSQLQLPLLVLTLVASILSGKVENKPW
Ga0314702_129757813300032725SeawaterGCIAGSRWNLEGVLSFSEIPAEFASFVEAKQKELAFNMLSSSAAGVVLANLAALVAGDASLEVLVQTCQLQIPLLILTLIASILSGKVENKPW
Ga0314702_133513513300032725SeawaterDEFADFVKAKQQQLAFNMLSSSAAGVVLANLAALVAGDASLDLLVEISKAQIPLLVLTLIASVASGNKKIAEIKPW
Ga0314702_136994013300032725SeawaterIDGVLSFSEIPAEFADFVQAKQQELAFNMLSSSAAGVLLANLAALIAGDASVEVLVQTSQLQIPLLVLTLVASVLSGKVEDKPW
Ga0314693_1014149823300032727SeawaterVLSFSEIPAEFAEFVQSKQQELAFNMLSSSAAGVVLANFAALLAGDASVELLLQTSQAQIPLLILTLIASILSGKVEDKPW
Ga0314693_1063070313300032727SeawaterVLSFSEIPAEFAGFVAAKRKELAFNMLSSSAAGVVLANLAALVAGDASLEVLAQTAQLQIPLLILTLIASVLSGKVENKPW
Ga0314693_1067073913300032727SeawaterDGVLSFSEVPDEFAGFVREKQRELAFNMLSSSAAGVVLANLAALVAGDATMELLVQTCQLQIPLLVLTLIASVLSGKVESKPW
Ga0314693_1070590213300032727SeawaterFSEIPSEFADFVKSKQQQLAFNMLSSSAAGVVLASLAALVAGDATVQLLVQLCQAQIPLLILTLIASILSGKVENKPW
Ga0314696_1050632623300032728SeawaterVLSFSEIPSEFADFVTSKQQQLAFNMLSSSAAGVVLASLAALVAGDATVQLLVQLCQAQIPLLILTLIASILSGKVENKPW
Ga0314706_1011112323300032734SeawaterVLSFSTIPAEFADFVAAKQRQLAFSMLSSSATGVVFANLAALVAGDASVELLVQTSQAQVPLLVLTLLASILSGKVENKPW
Ga0314710_1049722813300032742SeawaterGSRWNIDGVLSFSEIPAEFADFVQAKQQELAFNMLSSSAAGVLLANLAALIAGDASVEVLVQTSQLQIPLLVLTLVASVLSGKVEDKPW
Ga0314704_1042480123300032745SeawaterVLSLSEIPAEFAEFVKTKQRELAFNMLSSSAAGVLLANLAAFVAGDASVELLIQTSQAQIPLLILTLIASILSGKVENKPW
Ga0314692_1029299823300032754SeawaterVLSFSEIPAEFADFVKTKQRELAFNMLSSSAAGVVVANLAALVAGDASVNVLVETSQAQIPLLIFTLVASILSGKVENKPW
Ga0314709_1058394213300032755SeawaterIDGVLTFSEIPAEFADFVQAKQRELAFNMLSSSAAGVLLANLAALVAGDASAEVLVQTSQLQIPLLVLTLVASILSGKVENKPW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.