3300017150: Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 566 ?mol photons light - Emiliania huxleyi CCMP 370 (MMETSP1155)

Overview

Basic Information

• IMG/M Taxon OID: 3300017150
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0211927 | Ga0186215
• Sample Name: Metatranscriptome of marine eukaryotic communities from unknown location in Aquil nutrients amended seawater with alpha-glycerophosphate, at 20 C, 35 psu salinity and 566 ?mol photons light - Emiliania huxleyi CCMP 370 (MMETSP1155)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 37238782
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi	1
All Organisms → cellular organisms → Eukaryota	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021038	Metagenome / Metatranscriptome	220	Y
F049399	Metagenome / Metatranscriptome	146	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186215_114131	All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi	979
Ga0186215_117594	All Organisms → cellular organisms → Eukaryota	826

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186215_114131	Ga0186215_1141311	F049399	MSEIPAEFADFVQAKQRQLALNVLTSSAAGVVLANLAALVAGDASLDLFAEIVQTQLPLIALTGAAAVLSG
Ga0186215_117594	Ga0186215_1175941	F021038	PEEGSSVPAERGEEDTLERNGGACIQPCRSSTLTSPRSSSMRMMSIQNFGFFVMYFAIWLATPAADVCAESRFAEGFMALTCFLVSFLCIGMGFGGYVDDGFTFPFYWIAHAVPAVGGYTTCTFLIPMARFSETGEACATLAPVVGSAVQAVYIVHAGLYWCYVCNMVSVTYFSFLKPTFGLKFKASICVALLALIEAIVFGAMAQYGVFAASPLPSASKKLFGMF