x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300017261
3300017261: Metatranscriptome of marine eukaryotic communities from English Channel in enriched f/2 medium with filtered seawater, 15 C, 35 psu salinity and 328 ?mol photons light - Coccolithus braarudii PLY182g (MMETSP0164_2)
Overview
Basic Information
IMG/M Taxon OID 3300017261 Open in IMG/M
GOLD Reference (Study | Sequencing Project | Analysis Project) Gs0128947 | Gp0212175 | Ga0186463
Sample Name Metatranscriptome of marine eukaryotic communities from English Channel in enriched f/2 medium with filtered seawater, 15 C, 35 psu salinity and 328 ?mol photons light - Coccolithus braarudii PLY182g (MMETSP0164_2)
Sequencing Status Permanent Draft
Sequencing Center National Center for Genome Resources
Published? N
Use Policy Open
Dataset Contents
Total Genome Size 28146103
Sequencing Scaffolds 3
Novel Protein Genes 3
Associated Families 3
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi 1
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Calcidiscaceae → Calcidiscus → Calcidiscus leptoporus 1
All Organisms → cellular organisms → Eukaryota → Haptista 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Type Host-Associated
Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Location Information
Location English Channel
Coordinates Lat. (o ) 50.033 Long. (o ) 4.366 Alt. (m) N/A Depth (m) 10
Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F024007 Metagenome / Metatranscriptome 207 Y F049399 Metagenome / Metatranscriptome 146 Y F050105 Metagenome / Metatranscriptome 145 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0186463_103563 All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi 1500 Open in IMG/M Ga0186463_110164 All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Calcidiscaceae → Calcidiscus → Calcidiscus leptoporus 968 Open in IMG/M Ga0186463_111317 All Organisms → cellular organisms → Eukaryota → Haptista 901 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0186463_103563 Ga0186463_1035631 F049399 VLSFSEIPAEFAGFVKAKQKELAFNMLSSSAVGVVFANIAALVAGDASVELLVQTCQLQIPLLILTLIASVLSGKVENKPW Ga0186463_110164 Ga0186463_1101641 F050105 GGGASDAFLGAHLVTDRGRKKLRADRYVELRRLLPRRLLKLLQAWYSSLRKTPSETAAFQEKTRRHEYFPEVLSTFLNLALEPLASAMSQTTVAPTYPFPITYVPGGGIHPHLDVSDNELSLTFQVQLEGEIPQWPLVFLDPRGQELSNLNASKAKQVVLKDNDGVLYYGPDIVHWRENQLSTLTQIVFAFREEDVTHCNNQ Ga0186463_111317 Ga0186463_1113172 F024007 LKIMAKAAPHAQPTNDGGIVVALVLLVAALASIFFGAVALYASADIVLTSEQKQKSVRARRLARLLSGWANVGNAAVHGLLIIMLVTDSERYKQFFPDEAEMPLGTAFMLVLNLLVGRCTLKGGGIVLALIWNSFVAVAGSLIPVVWPKFLDVGMITWPYLAVFLWLSIFAFESFAFFFSVVAFALKDAHAVKED