NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300017261

3300017261: Metatranscriptome of marine eukaryotic communities from English Channel in enriched f/2 medium with filtered seawater, 15 C, 35 psu salinity and 328 ?mol photons light - Coccolithus braarudii PLY182g (MMETSP0164_2)



Overview

Basic Information
IMG/M Taxon OID3300017261 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128947 | Gp0212175 | Ga0186463
Sample NameMetatranscriptome of marine eukaryotic communities from English Channel in enriched f/2 medium with filtered seawater, 15 C, 35 psu salinity and 328 ?mol photons light - Coccolithus braarudii PLY182g (MMETSP0164_2)
Sequencing StatusPermanent Draft
Sequencing CenterNational Center for Genome Resources
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size28146103
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Calcidiscaceae → Calcidiscus → Calcidiscus leptoporus1
All Organisms → cellular organisms → Eukaryota → Haptista1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameThe Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEnglish Channel
CoordinatesLat. (o)50.033Long. (o)4.366Alt. (m)N/ADepth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024007Metagenome / Metatranscriptome207Y
F049399Metagenome / Metatranscriptome146Y
F050105Metagenome / Metatranscriptome145Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0186463_103563All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Isochrysidales → Noelaerhabdaceae → Emiliania → Emiliania huxleyi1500Open in IMG/M
Ga0186463_110164All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Calcidiscaceae → Calcidiscus → Calcidiscus leptoporus968Open in IMG/M
Ga0186463_111317All Organisms → cellular organisms → Eukaryota → Haptista901Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0186463_103563Ga0186463_1035631F049399VLSFSEIPAEFAGFVKAKQKELAFNMLSSSAVGVVFANIAALVAGDASVELLVQTCQLQIPLLILTLIASVLSGKVENKPW
Ga0186463_110164Ga0186463_1101641F050105GGGASDAFLGAHLVTDRGRKKLRADRYVELRRLLPRRLLKLLQAWYSSLRKTPSETAAFQEKTRRHEYFPEVLSTFLNLALEPLASAMSQTTVAPTYPFPITYVPGGGIHPHLDVSDNELSLTFQVQLEGEIPQWPLVFLDPRGQELSNLNASKAKQVVLKDNDGVLYYGPDIVHWRENQLSTLTQIVFAFREEDVTHCNNQ
Ga0186463_111317Ga0186463_1113172F024007LKIMAKAAPHAQPTNDGGIVVALVLLVAALASIFFGAVALYASADIVLTSEQKQKSVRARRLARLLSGWANVGNAAVHGLLIIMLVTDSERYKQFFPDEAEMPLGTAFMLVLNLLVGRCTLKGGGIVLALIWNSFVAVAGSLIPVVWPKFLDVGMITWPYLAVFLWLSIFAFESFAFFFSVVAFALKDAHAVKED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.