NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039672

Metagenome / Metatranscriptome Family F039672

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039672
Family Type Metagenome / Metatranscriptome
Number of Sequences 163
Average Sequence Length 192 residues
Representative Sequence MAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQ
Number of Associated Samples 128
Number of Associated Scaffolds 163

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 66.87 %
% of genes near scaffold ends (potentially truncated) 77.30 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (97.546 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh
(34.356 % of family members)
Environment Ontology (ENVO) Unclassified
(36.810 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(99.387 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 10.00%    β-sheet: 36.00%    Coil/Unstructured: 54.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003216|JGI26079J46598_1052200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300003712|Ga0008276_103350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum741Open in IMG/M
3300003714|Ga0008272_104282All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum689Open in IMG/M
3300003714|Ga0008272_109013All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300003716|Ga0008281_102322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum707Open in IMG/M
3300003718|Ga0008277_102283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300003733|Ga0008273_1004709All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300003909|JGI26087J52781_1024453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300004507|Ga0008280_1037905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum825Open in IMG/M
3300005941|Ga0070743_10149773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300006356|Ga0075487_1516584All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300006357|Ga0075502_1000224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300006357|Ga0075502_1662752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces turgidiscabies642Open in IMG/M
3300006382|Ga0075494_1377714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300006383|Ga0075504_1396429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300006383|Ga0075504_1407664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum776Open in IMG/M
3300006390|Ga0075509_1506653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum726Open in IMG/M
3300006390|Ga0075509_1524960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300006390|Ga0075509_1525243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. 9128745Open in IMG/M
3300006392|Ga0075507_1525001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300006396|Ga0075493_1524166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300006399|Ga0075495_1053074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300006399|Ga0075495_1054021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300006400|Ga0075503_1625582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces turgidiscabies777Open in IMG/M
3300006400|Ga0075503_1662504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300006400|Ga0075503_1673611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300006401|Ga0075506_1763153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300006401|Ga0075506_1769780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum653Open in IMG/M
3300006401|Ga0075506_1777692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300006403|Ga0075514_1874696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Curtobacterium → unclassified Curtobacterium → Curtobacterium sp. 9128686Open in IMG/M
3300006419|Ga0075496_1502551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300006425|Ga0075486_1745978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300006602|Ga0075484_1495131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300007231|Ga0075469_10129680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300007665|Ga0102908_1055260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300007667|Ga0102910_1039451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1076Open in IMG/M
3300007864|Ga0105749_1048418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300007972|Ga0105745_1097841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300007981|Ga0102904_1081364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum748Open in IMG/M
3300009002|Ga0102810_1193586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium625Open in IMG/M
3300009024|Ga0102811_1104110All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1062Open in IMG/M
3300009050|Ga0102909_1048611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1062Open in IMG/M
3300009057|Ga0102892_1027381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1062Open in IMG/M
3300009071|Ga0115566_10258066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1041Open in IMG/M
3300009071|Ga0115566_10402952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum788Open in IMG/M
3300009086|Ga0102812_10288421All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum893Open in IMG/M
3300009263|Ga0103872_1006735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1046Open in IMG/M
3300009265|Ga0103873_1027973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum986Open in IMG/M
3300009265|Ga0103873_1028232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum983Open in IMG/M
3300009434|Ga0115562_1115424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1041Open in IMG/M
3300009442|Ga0115563_1199193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300009445|Ga0115553_1126969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1063Open in IMG/M
3300009472|Ga0115554_1170934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum891Open in IMG/M
3300009508|Ga0115567_10275267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1063Open in IMG/M
3300009606|Ga0115102_10385972All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum730Open in IMG/M
3300010309|Ga0102890_1030702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1052Open in IMG/M
3300012472|Ga0129328_1090660All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum688Open in IMG/M
3300012516|Ga0129325_1199451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300012516|Ga0129325_1397965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum766Open in IMG/M
3300012522|Ga0129326_1114072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300012524|Ga0129331_1147573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300016689|Ga0182050_1024379All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300016703|Ga0182088_1132631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum724Open in IMG/M
3300016703|Ga0182088_1327344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum777Open in IMG/M
3300016723|Ga0182085_1171078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum729Open in IMG/M
3300016723|Ga0182085_1251742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum756Open in IMG/M
3300016724|Ga0182048_1067850All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300016724|Ga0182048_1108843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300016729|Ga0182056_1218439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum827Open in IMG/M
3300016731|Ga0182094_1035809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum722Open in IMG/M
3300016732|Ga0182057_1111135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300016734|Ga0182092_1165187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300016734|Ga0182092_1285331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum669Open in IMG/M
3300016734|Ga0182092_1378808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum770Open in IMG/M
3300016734|Ga0182092_1551042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum757Open in IMG/M
3300016736|Ga0182049_1188614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300016736|Ga0182049_1294566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300016737|Ga0182047_1468848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300016740|Ga0182096_1036558All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1011Open in IMG/M
3300016742|Ga0182052_1063680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300016746|Ga0182055_1238417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300016748|Ga0182043_1071827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300016748|Ga0182043_1101638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum729Open in IMG/M
3300016749|Ga0182053_1032370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300016751|Ga0182062_1071113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum670Open in IMG/M
3300016766|Ga0182091_1235208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum878Open in IMG/M
3300016776|Ga0182046_1568161All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300017818|Ga0181565_10320842All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1036Open in IMG/M
3300017951|Ga0181577_10289869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1065Open in IMG/M
3300017957|Ga0181571_10507463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum736Open in IMG/M
3300018410|Ga0181561_10321671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300018413|Ga0181560_10178272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1051Open in IMG/M
3300018415|Ga0181559_10491777All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300018418|Ga0181567_10507815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum787Open in IMG/M
3300018426|Ga0181566_10577102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300018565|Ga0188826_111507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300018574|Ga0188842_1007205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300018599|Ga0188834_1015665All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum787Open in IMG/M
3300018601|Ga0188850_1013284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300018601|Ga0188850_1013287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum753Open in IMG/M
3300018601|Ga0188850_1013705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300018632|Ga0188873_1010324All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum771Open in IMG/M
3300018632|Ga0188873_1014162All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300018640|Ga0188880_1016108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300018926|Ga0192989_10087417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300019095|Ga0188866_1017073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300019191|Ga0180035_1099398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum742Open in IMG/M
3300019196|Ga0182087_1059005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum682Open in IMG/M
3300019200|Ga0180036_1027134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum750Open in IMG/M
3300019200|Ga0180036_1039989All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum855Open in IMG/M
3300019253|Ga0182064_1040355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300019261|Ga0182097_1217380All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300019261|Ga0182097_1476793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum907Open in IMG/M
3300019266|Ga0182061_1245191All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300019266|Ga0182061_1301374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum770Open in IMG/M
3300019266|Ga0182061_1489099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300019272|Ga0182059_1452287All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum744Open in IMG/M
3300019272|Ga0182059_1554905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300019272|Ga0182059_1555512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300019276|Ga0182067_1376143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum735Open in IMG/M
3300019283|Ga0182058_1185146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300019283|Ga0182058_1189731All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum700Open in IMG/M
3300020013|Ga0182086_1067339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum738Open in IMG/M
3300021268|Ga0210294_137364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300021284|Ga0210299_133328All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300021296|Ga0210300_106808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300021303|Ga0210308_1009066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum798Open in IMG/M
3300021323|Ga0210295_1067249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300021325|Ga0210301_1130636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum779Open in IMG/M
3300021325|Ga0210301_1187947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum695Open in IMG/M
3300021336|Ga0210307_1138644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum916Open in IMG/M
3300021336|Ga0210307_1143825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1058Open in IMG/M
3300021378|Ga0213861_10210571All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1052Open in IMG/M
3300021389|Ga0213868_10552613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300022374|Ga0210311_1025518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300022375|Ga0210313_1022479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum743Open in IMG/M
3300022929|Ga0255752_10278388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300023105|Ga0255782_10512885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300023108|Ga0255784_10310566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum781Open in IMG/M
3300023175|Ga0255777_10238344All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1065Open in IMG/M
3300023706|Ga0232123_1059078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300023706|Ga0232123_1060079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum747Open in IMG/M
3300023709|Ga0232122_1127044All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300023709|Ga0232122_1137791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300024343|Ga0244777_10288338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1038Open in IMG/M
3300024346|Ga0244775_10435055All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1076Open in IMG/M
3300025608|Ga0209654_1093002All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum823Open in IMG/M
3300025620|Ga0209405_1075355All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1041Open in IMG/M
3300025636|Ga0209136_1073180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1063Open in IMG/M
3300025684|Ga0209652_1144542All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300025690|Ga0209505_1072619All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1041Open in IMG/M
3300025767|Ga0209137_1173340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum756Open in IMG/M
3300025879|Ga0209555_10129574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1063Open in IMG/M
3300025881|Ga0209309_10237326All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum856Open in IMG/M
3300026470|Ga0247599_1070932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum734Open in IMG/M
3300026495|Ga0247571_1081273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300026503|Ga0247605_1085969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300027188|Ga0208921_1019152All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1052Open in IMG/M
3300027525|Ga0208437_1066461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum851Open in IMG/M
3300027571|Ga0208897_1102256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum729Open in IMG/M
3300028290|Ga0247572_1144910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300028524|Ga0210314_123067All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300032517|Ga0314688_10783856All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh34.36%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous17.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine16.56%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake6.13%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine6.13%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine4.29%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.29%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.68%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.84%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.84%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.23%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.23%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.61%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003712Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003714Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003716Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003718Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003733Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300006356Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006392Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006602Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300007981Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3EnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009508Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012522Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016689Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011509AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016723Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041405ZT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016724Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011507AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016729Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101402AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016731Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041412AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016732Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101403AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016736Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011508BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017818Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018410Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011510BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018415Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011508AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018418Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018565Metatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dTEnvironmentalOpen in IMG/M
3300018574Metatranscriptome of marine microbial communities from Baltic Sea - GS677_3p0_dTEnvironmentalOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018601Metatranscriptome of marine microbial communities from Baltic Sea - GS679_3p0_dTEnvironmentalOpen in IMG/M
3300018632Metatranscriptome of marine microbial communities from Baltic Sea - GS848_ls3EnvironmentalOpen in IMG/M
3300018640Metatranscriptome of marine microbial communities from Baltic Sea - GS859_ls5EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019191Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019196Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019253Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101410AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019276Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101413AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019283Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021268Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63.3A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021284Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021296Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R881 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300022374Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1166 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022929Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaGEnvironmentalOpen in IMG/M
3300023105Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaGEnvironmentalOpen in IMG/M
3300023108Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101403AT metaGEnvironmentalOpen in IMG/M
3300023175Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaGEnvironmentalOpen in IMG/M
3300023706Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011504AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025620Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025684Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_74LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025690Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes)EnvironmentalOpen in IMG/M
3300025767Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025881Pelagic marine microbial communities from North Sea - COGITO_mtgs_120412 (SPAdes)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027188Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027571Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028524Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26079J46598_105220013300003216MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLN
Ga0008276_10335013300003712MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSHIWESSNVLNRVWVVVVSLDSSSSGDKSAISQ
Ga0008272_10428213300003714MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETRHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESS
Ga0008272_10901313300003714MarineMSLKSKVGTRTFTSKRVVRRLPECSAEVVLSTLLFEEIELLEGLQSVDSEDKRIVGGHTKTVHEFLELDVIEDHSGDVVGVHFSHRLVGLGLNLSGDTVGVSEDSSSDLGAEGSGVVVSLGLGVGDSEREILGDLIKVGLDGGEELSLWVLLNLSSLSSGGLVGSDVLVGNGISSNIWESRNVLNRVWVMVVSLDG
Ga0008281_10232213300003716MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNV
Ga0008277_10228313300003718MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGS
Ga0008273_100470913300003733MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQ
JGI26087J52781_102445313300003909MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNG
Ga0008280_103790513300004507MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWLILKPFTRGSWSVDAAACAWHLSPSFRMLVFPLAYSRVR*
Ga0070743_1014977313300005941EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI*
Ga0075487_151658413300006356AqueousMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDGEDESVWGGHTEAGHELLELDVVEDHSGDVVGVLFGHGLVGLGLNLGGDTVGVSEDGIGHLVAEVSGVVVSLGLGVGDSERKVLGDLIEIGLDGGEELSLWVLLNLSGLSSGRLVSGDVLIGNGISSDIWEGGNVLNRVWVVVVSLDGSGGGDKSAISQ
Ga0075502_100022413300006357AqueousRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSG
Ga0075502_166275213300006357AqueousMSLTAQNGPTISSNLSRGLLRCSREIVFSTLLFEEIELLEGLQSVDSEDKSVVRSHTETVHELLELDIVEDEGRDVVGVLLSHHLVGLGLNLGGDTISVSEDSGGDLVAECSGVVVSLLLRVRNTEGEVLGDLVEVVFDGGHEFSLWVLLNLGSLSSSRLVSSNILIRDGVGSNI
Ga0075494_137771413300006382AqueousMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLSGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0075504_139642913300006383AqueousLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELSLWVLLNLSSLSSGGLVSSDVLIGNGISSDIWESRNVLNRVWVVVVSLDGSSGSDKSAISQEFHYLI*
Ga0075504_140766413300006383AqueousMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDGKDKSVVGSHTETGHELLELDVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQEF
Ga0075509_150665313300006390AqueousLLEKIKLLEGLQSVDSKDKCVIWSHTETVHELLNLDVVEDHGGDVMGVLFGHGLVSVGLNLSGDSVSVSEDSSSDLVAETSGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELSLWVLLNLSSLSSGGLVSSDVLIGNGISSDIWESSNVLNRVWVVVVSLDGSGGGDKSAISQ
Ga0075509_152496013300006390AqueousPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQEF
Ga0075509_152524313300006390AqueousVAARFSKFVAEIGVHSPKMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDGKDKSVVGSHTETGHELLELDVVEDHGGDVVGVHFGHGLVGLGLNLSGDTVGVSEDGISDLVAEVSGVVVSLGLGVGDSERKVLGDLIEVGLDGGEELGLWVLLNLSGLSSSGLVSGDILIGDGIGSNIWESGNVLNRVWVVVVSLDGS
Ga0075507_152500113300006392AqueousMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWV
Ga0075493_152416613300006396AqueousPSLWRKFGVLSPKMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDGEDESVWGGHTEAGHELLELDVVEDHSGDVVGVLFGHGLVGLGLNLGGDTVGVSEDGIGHLVAEVSGVVVSLGLGVGDSERKVLGDLIEIGLDGGEELSLWVLLNLSGLSSGRLVSGDVLIGNGISSDIWEGGNVLNRVWVVVVSLDGSGGGDKSAICQE
Ga0075495_105307413300006399AqueousMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETRHEVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISS
Ga0075495_105402113300006399AqueousMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISS
Ga0075503_162558213300006400AqueousMSLTAQNGPTISSNLSRGLLRCSREIVFSTLLFEEIELLEGLQSVDSEDKSVVRSHTETVHELLELDIVEDEGRDVVGVLLSHHLVGLGLNLGGDTISVSEDSGGDLVAECSGVVVSLLLRVRNTEGEVLGDLVEVVFDGGHEFSLWVLLNLGSLSSSRLVSSNILIRDGVGSNIWEGRNVLNGVWVVVVSGDCGSRGDESAISQEFHYLF*
Ga0075503_166250413300006400AqueousLLEKIKLLEGLQSVDSKDKCVIWSHTETVHELLNLDVVEDHGGDVMGVLFGHGLVSVGLNLSGDSVSVSEDSSSDLVAETSGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELSLWVLLNLSSLSSGGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0075503_167361113300006400AqueousSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSG
Ga0075506_176315313300006401AqueousRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQEFH
Ga0075506_176978013300006401AqueousLLEKIKLLEGLQSVDSKDKCVIWSHTETVHELLNLDVVEDHGGDVMGVLFGHGLVSVGLNLSGDSVSVSEDSSSDLVAETSGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELSLWVLLNLSSLSSGGLVSSDVLIGNGISSDIWES
Ga0075506_177769213300006401AqueousVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSG
Ga0075514_187469613300006403AqueousVAARFSKFVAEIGVHSPKMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDGKDKSVVGSHTETGHELLELDVVEDHGGDVVGVHFGHGLVGLGLNLSGDTVGVSEDGISDLVAEVSGVVVSLGLGVGDSERKVLGDLIEVGLDGGEELGLWVLLNLSGLSSSGLVSGDILIGDGIGSNIWESGNVLNRVWVVVVS
Ga0075496_150255113300006419AqueousMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0075486_174597813300006425AqueousMRLPECSAEVVLSTLLFEEIELLEGLQSVDGEDESVWGGHTEAGHELLELDVVEDHSGDVVGVLFGHGLVGLGLNLSGDSVGVSEDGGGDLLAEGSGVVVSLGLGVGDSEREVLGDLVEIGLDGGEKLSLWVLLNLSGLGSGALVSGDVLIGDGISSDIWESSNVLNRVWVVVVSLDGSGGGDKSAISQEF
Ga0075484_149513113300006602AqueousVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVSVSEEGGSDLVAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSA
Ga0075469_1012968013300007231AqueousLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI*
Ga0102908_105526013300007665EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNG
Ga0102910_103945113300007667EstuarineMSPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKNKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI*
Ga0105749_104841813300007864Estuary WaterLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0105745_109784113300007972Estuary WaterMAPDLTSKRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKNKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSSDKSAISQE
Ga0102904_108136413300007981EstuarineCSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYLI*
Ga0102810_119358613300009002EstuarineSKVAPDFTSKSVGLRLPECSAEAVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGGGDKSAISQEFHYL
Ga0102811_110411013300009024EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI*
Ga0102909_104861113300009050EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI*
Ga0102892_102738113300009057EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI*
Ga0115566_1025806623300009071Pelagic MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI*
Ga0115566_1040295213300009071Pelagic MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETRHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNG
Ga0102812_1028842113300009086EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYL
Ga0103872_100673513300009263Surface Ocean WaterLLEKIKLLEGLQSVDSKDKCVIWSHTETVHELLNLDVVEDHGGDVVGVLFGHGLVSVGLNLSSDSVSVSEDSGSDLVAEASGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELSLWVLLNLSSLSSGGLVSSDILIGNGISSDIWESRNVLNRVWVVVVSLDGSGGSDKSAISQEFHYLI
Ga0103873_102797313300009265Surface Ocean WaterLLEKIKLLEGLQSVDSKDKCVIWSHTETVHELLNLDVVEDHGGDVVGVLFGHGLVSVGLNLSGDSVSVSEDSGSDLVAEASGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELSLWVLLNLSSLSSGGLVSSDILIGNGISSDIWESRNVLNRVWVVVVSLDGSGGSDKSAISQEFHYLI
Ga0103873_102823213300009265Surface Ocean WaterLFEQVELLEGLQSVDSEDEVVISSHTEARHELLELDVIEDHGGDVMGVQLGHGLVGLGLNLGGDAVGVALDGGGDLDAEVSSMVVSLLLGVRDAEGKIFGDLVQVELDSGEHLQLWVLLHLGSLGSGGLVGSDVLIRDGIGSNIWEGGHVLGGAWVVVVVVSHESRGRSSGNKSAVSQEFHYLI*
Ga0115562_111542423300009434Pelagic MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVALDGSEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI*
Ga0115563_119919313300009442Pelagic MarineLFEKIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVPEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0115553_112696913300009445Pelagic MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGSHTETRHEVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI*
Ga0115554_117093413300009472Pelagic MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFV*
Ga0115567_1027526713300009508Pelagic MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVGGHTETRHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI*
Ga0115102_1038597213300009606MarineMAPDLISKRVGQQLPGSSAEVVLSTLLFEEIELLEGLQSVDSKDKCVVSSHTETVHELLELDIVEDEGRDVVGVQLGHGLVGLGLDLSGDSVSVSEDGGGDLVAEFSGVVVSLLLRVRDTEGEVLGDLVKVVLDGGHEFSLWVLVNLGSLRSGSLVSSNILIRDGVSSNIWESRYVLNRVWVVVVSLDCGGRGDESAISQEF
Ga0102890_103070223300010309EstuarineMSPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKNKSIVGGHTETRHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI*
Ga0129328_109066013300012472AqueousMAPDLTSKRVGQRLPECSAEVVLSTLLFEKIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGNGSGDKSAISQE
Ga0129325_119945113300012516AqueousREIVFSTLLFEEIELLEGLQSVDSKDKSVISSHTETVHELLELDIVEDEGRDVVGVLLSHHLVGLGLNLGGDTISVSEDSGGDLVAECSGVVVSLLLRVRNTEGEVLGDLVEVVLDGGHEFSLWVLLNLGSLSSSRLVSSNILIRDGVGSNIWEGRNVLNGVWVVVVSGDCGSRGDESAISQEF
Ga0129325_139796513300012516AqueousMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVTSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQEFH
Ga0129326_111407213300012522AqueousLFEEIELLEGLQSVDSEDKSVISSHTETVHELLELDIVEDEGRDVVGVLLSHHLVGLGLNLGGDTISVSEDSGGDLVAECSGVVVSLLLRVRNTEGEVLGDLVEVVLDGGHEFSLWVLLNLGSLSSSRLVSSNILIRDGVGSNIWEGRNVLNGVWVVVVSGDCGSRGDESAISQEF
Ga0129331_114757313300012524AqueousMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSG
Ga0182050_102437913300016689Salt MarshPKMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSPDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0182088_113263113300016703Salt MarshMRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVGGHTKTVHELLELDIVEDEGGDVVGVQLGHGLVGLGLNLSGDSVGVSEDGGGDLLAEGSGVVVSLGLGVGDSEREVLGDLVEIGLDGGEELSLWVLLNLSGLGSGALVSGDVLIGDGISSDIWESSNVLNRVWVVVVSLDGSGGGDKSAIS
Ga0182088_132734413300016703Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVRGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLRVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEF
Ga0182085_117107813300016723Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFSSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQ
Ga0182085_125174213300016723Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHY
Ga0182048_106785013300016724Salt MarshEGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGGDLVAEGSGVVVSLLLRVGHSEREILGDLVEVTLDGGEELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAIC
Ga0182048_110884313300016724Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWE
Ga0182056_121843913300016729Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFLYLI
Ga0182094_103580913300016731Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFSSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSA
Ga0182057_111113513300016732Salt MarshSPKMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESRNVLNRVWVVVVSLDGSSGSDKSAISQEF
Ga0182092_116518713300016734Salt MarshVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDGEDESVWGGHTEAGHELLELDVVEDHSGDVVGVLFGHGLVGLGLNLGGDTVGVSEDGIGHLVAEVSGVVVSLGLGVGDSERKVLGDLIEIGLDGGEELSLWVLLNLSGLSSGRLVSGDVLIGNGISSDIWESSNVLN
Ga0182092_128533113300016734Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWV
Ga0182092_137880813300016734Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVRGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFSSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQ
Ga0182092_155104213300016734Salt MarshMRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVGGHTKTVHELLELDIVEDEGGDVVGVQLGHGLVGLGLNLSGDSVGVSEDGGGDLLAEGSGVVVSLGLGVGDSEREVLGDLVEIGLDGGEELSLWVLLNLSGLGSGALVSGDVLIGDGISSDIWESSNVLNRVWVVVVSLDGSGGGDKSAISQEFHYLY
Ga0182049_118861413300016736Salt MarshMRLPECSAEVVLSTLLFEEIELLEGLQSVDGEDESVWGGHTEAGHELLELDVVEDHSGDVVGVLFGHGLVGLGLNLGGDTVGVSEDGIGHLVAEVSGVVVSLGLGVGDSERKVLGDLIEIGLDGGEELSLWVLLNLSGLSSGRLVSGDVLIGNGISSDIWEGGNVLNRVWVVVVSLDGSGGGDKSAICQEF
Ga0182049_129456613300016736Salt MarshRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0182047_146884813300016737Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGVDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0182096_103655813300016740Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGKELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0182052_106368013300016742Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVRGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEEGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGKELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEF
Ga0182055_123841713300016746Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVFLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEF
Ga0182043_107182713300016748Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVRGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEEGGSDLVAEGSGVVVSLLLGVGHSEREILGDLVEVTLDGGEELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQE
Ga0182043_110163813300016748Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQE
Ga0182053_103237013300016749Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEEGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQ
Ga0182062_107111313300016751Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVRGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFSSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEF
Ga0182091_123520813300016766Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIIWGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGKELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEFHY
Ga0182046_156816113300016776Salt MarshMRLPECSAEVVLSTLLFEEIELLEGLQSVDGEDESVWGGHTEAGHELLELDVVEDHSGDVVGVLFGHGLVGLGLNLGGDTVGVSEDGIGHLVAEVSGVVVSLGLGVGDSERKVLGDLIEIGLDGGEELSLWVLLNLSGLSSGRLVSGDVVIGNGISSDIWEGGNV
Ga0181565_1032084213300017818Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0181577_1028986913300017951Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVVGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGKELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEFHYFI
Ga0181571_1050746313300017957Salt MarshLPECSAEVVLSTLLFEEIELLEGLQSVDGKDKSIVRGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGGDLVAEGSGVVVSLLLRVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFSSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEFHYFI
Ga0181561_1032167123300018410Salt MarshVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGGGDKSAISQEFHYLYY
Ga0181560_1017827223300018413Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGLSSGRLVSGDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0181559_1049177713300018415Salt MarshVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0181567_1050781523300018418Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVRGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLRVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFGSSSLVSSNVLIGNG
Ga0181566_1057710223300018426Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSQDGGGDLVAEGSGVVVSLLLGVGHSEREILGDLVEVTLDGGKELSLWVLLNLSGFGSSSLVSSNVLIGN
Ga0188826_11150713300018565Freshwater LakeVCSSEVVLSTLLFEEIEFLEGLQSVDGEDESIVGSHTETVHELLELHIVEDHGGDVVGVQFGHGLVGLGLNLSGDTIGVSEDGSSDLGAESSGVVVSLGLGVRDSEREVLGDLVKVGLDGGHELRLWVLLNLSGFGSGGLMGSDVLIGDGISSNVGESRHELNRVWVVVVVLNGSGSGDKSAISQEF
Ga0188842_100720513300018574Freshwater LakeMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVS
Ga0188834_101566513300018599Freshwater LakeMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEEGGSDLVAEGSGVVISLLLGVGDSEREILGDLVEVTLDGGKELSLWVLLNLSGFSSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEF
Ga0188850_101328413300018601Freshwater LakeMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQEFH
Ga0188850_101328713300018601Freshwater LakeMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVGGHTKTVHELLELDIVEDEGGDVVGVQLGHGLVGLGLNLSGDSVGVSEDGGGDLLAEGSGVVVSLGLGVGDSEREVLGDLVEIGLDGGEELSLWVLLNLSGLGSGALVSGDVLIGDGISSDIWESSNVLNRVWVVVVSLDGSGGGDKSAISQEFH
Ga0188850_101370513300018601Freshwater LakeMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSIVSSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVVVVSLDGSGGGDKSAISQ
Ga0188873_101032413300018632Freshwater LakeDTRSFWALVSHFQWRKMRLKSKVAPDFTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSIVSSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0188873_101416213300018632Freshwater LakeMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVISLLLGVGDSEREILGDLVEVTLDGGKELSLWVLLNLSGFSSSSLVSSNVLIGNGI
Ga0188880_101610813300018640Freshwater LakePDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0192989_1008741713300018926MarineLLEEVELLEGLQSVDSKDKSIISSHTETVHELLNLDVVEDHGGDVVGVLFGHGLVGVGLNLGGDSVSVSEDGGGDLVAEGSGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELGLWVLLNLSSLSSGGLVSSDVLIGNGISSDIWESRNVLNRVWVVVVSLDGSGGGDKSAISQEFHYLI
Ga0188866_101707313300019095Freshwater LakeMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLKGLQSVDSKDELVVGSHTETVHEFLDLNVVEDHGGDVVGVHFGHGLVGVGLNLGGDAVSVAEDGGGDLVAELSGVVVSLLLGVGDSEREVLGDLIEVGLDGGEELGLWVLLNLGGFGSGGLVGSNILIGDGISSNIWESSNVLNRVWVVVVSLDSSGSGDKSAISQEF
Ga0180035_109939813300019191EstuarineMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVTSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQEF
Ga0182087_105900513300019196Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEF
Ga0180036_102713413300019200EstuarineMSPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKNKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVALLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSG
Ga0180036_103998913300019200EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSCRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSG
Ga0182064_104035513300019253Salt MarshPECSAEVVLSTLLFEEIEFLEGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGKELSLWVFLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAIC
Ga0182097_121738013300019261Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQ
Ga0182097_147679313300019261Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVSSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0182061_124519113300019266Salt MarshLQSVDGKDKSVVGSHTETGHELLELDVVEDHGGDVVGVHFGHGLVGLGLNLSGDTVGVSEDGISDLVAEVSGVVVSLGLGVGDSERKVLGDLIEVGLDGGEELGLWVLLNLSGLSSSGLVSGDILIGDGIGSNIWESGNVLNRVWVVVVSLDGSGGSDKSAISQEF
Ga0182061_130137413300019266Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFSSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAI
Ga0182061_148909913300019266Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISH
Ga0182059_145228713300019272Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGEELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAI
Ga0182059_155490513300019272Salt MarshPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0182059_155551213300019272Salt MarshPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDGKDKSVVGSHTETGHELLELDVVEDHGGDVVGVHFGHGLVGLGLNLSGDTVGVSEDGISDLVAEVSGVVVSLGLGVGDSERKVLGDLIEVGLDGGEELGLWVLLNLSGLSSSGLVSGDILIGDGIGSNIWESGNVLNRVWVVVVSLDGSGGSDKSAISQEF
Ga0182067_137614313300019276Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAI
Ga0182058_118514613300019283Salt MarshSPKMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIIWGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGHSEREILGDLVEVTLDGGKELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEF
Ga0182058_118973113300019283Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGS
Ga0182086_106733913300020013Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQ
Ga0210294_13736413300021268EstuarineVISPKMSPDLTSIRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKSA
Ga0210299_13332813300021284EstuarineGIFGADTRSFWALVSHFQWRKMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVTSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRV
Ga0210300_10680813300021296EstuarineEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQ
Ga0210308_100906613300021303EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSCRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYL
Ga0210295_106724913300021323EstuarineMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLD
Ga0210301_113063613300021325EstuarineMSPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKNKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKS
Ga0210301_118794713300021325EstuarineSFWALVSHFQWRKMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0210307_113864413300021336EstuarineMSPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI
Ga0210307_114382523300021336EstuarineMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVTSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQEFHYLI
Ga0213861_1021057113300021378SeawaterMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI
Ga0213868_1055261313300021389SeawaterHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0210311_102551813300022374EstuarineMSPDLTSIRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWERSNVLNGVWGVVVSLDSS
Ga0210313_102247913300022375EstuarineMRLKSKVAPDFTSKRVGLRLPECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0255752_1027838813300022929Salt MarshLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0255782_1051288513300023105Salt MarshVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGS
Ga0255784_1031056613300023108Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGKELSLWVLLNLSGFGSSSLVSSNVLIG
Ga0255777_1023834413300023175Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGKELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEFHYFI
Ga0232123_105907813300023706Salt MarshMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVGGHTETGHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEEGGSDLVAEGSGVVVSLLLGVGDSEREILGDLVEVTLDGGKELSLWVLLNLSGFGSSSLVSSNVLIGNGISSHIWESRDVLNGVWVVMVVSLNSSSSGDKSAICQEF
Ga0232123_106007913300023706Salt MarshMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIEFLEGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEF
Ga0232122_112704413300023709Salt MarshGLQSVDGEDESVWGGHTEAGHELLELDVVEDHSGDVVGVLFGHGLVGLGLNLGGDTVGVSEDGIGHLVAEVSGVVVSLGLGVGDSERKVLGDLIEIGLDGGEELSLWVLLNLSGLSSGRLVSGDVLIGNGISSDIWEGGNVLNRVWVVVVSLDGSGGGDKSAICQEFHYLI
Ga0232122_113779113300023709Salt MarshGLQSVDSEDKSIVWSHTETGHEILNLNVVEDHGGDVVGVLLGHGLVGVGLNLGGDSVGVSEDSGGDLVAESSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSGLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0244777_1028833813300024343EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0244775_1043505513300024346EstuarineMSPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKNKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI
Ga0209654_109300213300025608MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVL
Ga0209405_107535513300025620Pelagic MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0209136_107318013300025636MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKDKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI
Ga0209652_114454213300025684MarineVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI
Ga0209505_107261923300025690Pelagic MarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0209137_117334013300025767MarinePDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0209555_1012957413300025879MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEVELLKGLQSVDGKNKSIVGGHTETRHVVLNLDVVEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSHIWESSNVLNGVWVVVVSLDSSSSGDKSAISQEFHYFI
Ga0209309_1023732613300025881Pelagic MarineMAPDLTSIRVGQRLPECSAEIVLSTLLFEEIELLKGLQSVDGKDKSIVGGHTETRHEVLNLDVIEDHGGDVMGVLLGHGLVGVGLNLGGDSVSVSEDGSGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYFI
Ga0247599_107093213300026470SeawaterLLEEVELLEGLQSVDSKDKSIISSHTETVHELLNLDVVEDHGGDVVGVLFGHGLVGVGLNLGGDSVSVSEDGGGDLVAEGSGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELGLWVLLNLSSLSSGGLVSSDVLIGNGISSDIWESRNVLNRVWVVVVS
Ga0247571_108127313300026495SeawaterLLEEVELLEGLQSVDSKDKSIISSHTETVHELLNLDVVEDHGGDVVGVLFGHGLVGVGLNLGGDSVSVSEDGGGDLVAEGSGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELGLWVLLNLSSLSSGGLVSSDVLIGNGISSDIWESRNVLNRVWVVVVSLDGSGGGDKSAISQEFH
Ga0247605_108596913300026503SeawaterLLEEVELLEGLQSVDSKDKSIISSHTETVHELLNLDVVEDHGGDVVGVLFGHGLVGVGLNLGGDSVSVSEDGGGDLVAEGSGVVVSLLLGVGDSEREVLGDLVKVGLDGGEELGLWVLLNLSSLSSGGLVSSDVLIGNGISSDIWESRNVLNRVWVVVVSLDGSGGGDKSAISQ
Ga0208921_101915223300027188EstuarineMSPDLTSIRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLDGSGSGDKSAISQEFHYLI
Ga0208437_106646113300027525EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEIALDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGVSSHIWESSNVLNRVWVMVVSLDGSG
Ga0208897_110225613300027571EstuarineMAPDLTSKRVGQRLPECSAEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHEVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGDSEREVLGDLVEVTLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESS
Ga0247572_114491013300028290SeawaterLEGLQSVDSEDKCVVRSHTETVHELLELDIVEDESRDVVGVQLGHHLVGLGLDESGDSVSVSEDGGGDLVAEFSGVVVSLALGEGDSEGEVLGDLVKVVLDGGHEFSLWVLVNLGSLRSGSLVSSNILIRDGVSSNIWESRYVLNRVWVVVVSLDCGGRGDESAISQ
Ga0210314_12306713300028524EstuarinePECSAEVVLSTLLFEEIEFLEGLQSVDSKDKSVVTSHTKTVHELLELNVVEDHGGDVVGVHFGHGLVSLGLNLSGDSVSVSEDSVSDLGAEGSGVVVSLGLRVRDTEGEVLGDLIEVGLDGGEELSLWVLLNLSSFSSGGLVSSDVLIGDGIGSNIWESRNVLNRVWVMVVSLDGSGGGDKSAISQEF
Ga0314688_1078385613300032517SeawaterEVVLSTLLFEEIELLEGLQSVDSKDKSVVSSHTKTGHVVLNLDVVEDHSGDVVGVLLSHGLVGVGLNLGGDSVSVSEDGGGDLGAEGSGVVVSLLLGVGNSEREVLGDLVEVSLDGGEELSLWVLLNLSGFGSSRLVSSDVLIGNGISSDIWESSNVLNRVWVMVVSLD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.