NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F036104

Metagenome / Metatranscriptome Family F036104

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F036104
Family Type Metagenome / Metatranscriptome
Number of Sequences 170
Average Sequence Length 35 residues
Representative Sequence MGQDGIPLSIGIIIAAAILGATFIAGMVLLAILFA
Number of Associated Samples 91
Number of Associated Scaffolds 170

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.12 %
% of genes near scaffold ends (potentially truncated) 4.71 %
% of genes from short scaffolds (< 2000 bps) 64.71 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.412 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface
(23.529 % of family members)
Environment Ontology (ENVO) Unclassified
(27.059 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(28.235 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 42.86%    β-sheet: 0.00%    Coil/Unstructured: 57.14%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 170 Family Scaffolds
PF00137ATP-synt_C 33.53
PF00430ATP-synt_B 21.18
PF00213OSCP 11.18
PF00119ATP-synt_A 11.18
PF02577BFN_dom 3.53
PF09527ATPase_gene1 2.94
PF02874ATP-synt_ab_N 2.94
PF00231ATP-synt 1.76
PF02896PEP-utilizers_C 1.18
PF02823ATP-synt_DE_N 1.18
PF13247Fer4_11 1.18
PF13286HD_assoc 1.18
PF05239PRC 1.18
PF13662Toprim_4 0.59
PF16177ACAS_N 0.59
PF01326PPDK_N 0.59
PF00027cNMP_binding 0.59
PF00886Ribosomal_S16 0.59
PF04023FeoA 0.59
PF00076RRM_1 0.59
PF12675DUF3795 0.59
PF13404HTH_AsnC-type 0.59

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 170 Family Scaffolds
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 33.53
COG0711FoF1-type ATP synthase, membrane subunit b or b'Energy production and conversion [C] 21.18
COG0356FoF1-type ATP synthase, membrane subunit aEnergy production and conversion [C] 11.18
COG0712FoF1-type ATP synthase, delta subunitEnergy production and conversion [C] 11.18
COG1259Bifunctional DNase/RNaseGeneral function prediction only [R] 3.53
COG0224FoF1-type ATP synthase, gamma subunitEnergy production and conversion [C] 1.76
COG0355FoF1-type ATP synthase, epsilon subunitEnergy production and conversion [C] 1.18
COG0228Ribosomal protein S16Translation, ribosomal structure and biogenesis [J] 0.59
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.59
COG1918Fe2+ transport protein FeoAInorganic ion transport and metabolism [P] 0.59


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.41 %
UnclassifiedrootN/A10.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001687|WOR8_10011666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia8836Open in IMG/M
3300001751|JGI2172J19969_10034858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1774Open in IMG/M
3300001751|JGI2172J19969_10053421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1318Open in IMG/M
3300001782|WOR52_10024713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi6281Open in IMG/M
3300002052|SMTZ1_10009759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi13951Open in IMG/M
3300002053|SMTZ23_10034087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi6990Open in IMG/M
3300002481|JGI24020J35080_1016178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1595Open in IMG/M
3300005645|Ga0077109_1000701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi18992Open in IMG/M
3300005645|Ga0077109_1063347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1140Open in IMG/M
3300005782|Ga0079367_1039350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia2071Open in IMG/M
3300005822|Ga0078744_1032674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1158Open in IMG/M
3300007351|Ga0104751_1223779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi649Open in IMG/M
3300008516|Ga0111033_1100528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi5330Open in IMG/M
3300008516|Ga0111033_1233029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi9485Open in IMG/M
3300009009|Ga0105105_10324023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi839Open in IMG/M
3300009034|Ga0115863_1004915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia20372Open in IMG/M
3300009034|Ga0115863_1032709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi6895Open in IMG/M
3300009034|Ga0115863_1034636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi6664Open in IMG/M
3300009034|Ga0115863_1037638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi6343Open in IMG/M
3300009034|Ga0115863_1535519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1335Open in IMG/M
3300009034|Ga0115863_1609344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1235Open in IMG/M
3300009034|Ga0115863_1641457Not Available1197Open in IMG/M
3300009034|Ga0115863_1683875Not Available1152Open in IMG/M
3300009127|Ga0118724_1000719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia47445Open in IMG/M
3300009127|Ga0118724_1026412All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia5144Open in IMG/M
3300009127|Ga0118724_1086875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1919Open in IMG/M
3300009127|Ga0118724_1133325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1352Open in IMG/M
3300009127|Ga0118724_1278297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi708Open in IMG/M
3300009127|Ga0118724_1294294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia641Open in IMG/M
3300009136|Ga0118735_10001869All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi7349Open in IMG/M
3300009136|Ga0118735_10167589All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300009136|Ga0118735_10338647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi524Open in IMG/M
3300009150|Ga0114921_10003476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi7740Open in IMG/M
3300009150|Ga0114921_10004610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi6914Open in IMG/M
3300009150|Ga0114921_10022623All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi3645Open in IMG/M
3300009150|Ga0114921_10041137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2841Open in IMG/M
3300009150|Ga0114921_10097933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1943Open in IMG/M
3300009150|Ga0114921_10204238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1380Open in IMG/M
3300009150|Ga0114921_10216041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1344Open in IMG/M
3300009150|Ga0114921_10413914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia977Open in IMG/M
3300009150|Ga0114921_10423522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi966Open in IMG/M
3300009150|Ga0114921_10970920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi633Open in IMG/M
3300009311|Ga0117906_1105062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium978Open in IMG/M
3300009488|Ga0114925_10057538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia2364Open in IMG/M
3300009488|Ga0114925_11155645Not Available567Open in IMG/M
3300009499|Ga0114930_10034088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia3296Open in IMG/M
3300009528|Ga0114920_10050140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2522Open in IMG/M
3300009528|Ga0114920_10081904All Organisms → cellular organisms → Bacteria2027Open in IMG/M
3300009528|Ga0114920_10139244All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300009528|Ga0114920_10372515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi968Open in IMG/M
3300009528|Ga0114920_10644881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium724Open in IMG/M
3300009528|Ga0114920_10814487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium639Open in IMG/M
3300009528|Ga0114920_10879262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi614Open in IMG/M
3300009528|Ga0114920_11056671All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300009529|Ga0114919_10044753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi3294Open in IMG/M
3300009529|Ga0114919_10212056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1377Open in IMG/M
3300009529|Ga0114919_10266621All Organisms → cellular organisms → Bacteria1208Open in IMG/M
3300009538|Ga0129287_10501043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi546Open in IMG/M
3300009538|Ga0129287_10527572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium531Open in IMG/M
3300009874|Ga0131789_10057347All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300010284|Ga0129301_1000838All Organisms → cellular organisms → Bacteria16205Open in IMG/M
3300010324|Ga0129297_10182518Not Available968Open in IMG/M
3300010324|Ga0129297_10541929Not Available508Open in IMG/M
3300010328|Ga0129298_10036591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi2345Open in IMG/M
3300010413|Ga0136851_10185457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2153Open in IMG/M
3300010995|Ga0139323_146515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi711Open in IMG/M
3300010996|Ga0139308_116424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1010Open in IMG/M
3300011340|Ga0151652_11218612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1052Open in IMG/M
3300011340|Ga0151652_12856919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1031Open in IMG/M
3300012931|Ga0153915_13184858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium533Open in IMG/M
3300012964|Ga0153916_11253709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia819Open in IMG/M
3300012964|Ga0153916_11668471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia711Open in IMG/M
3300012964|Ga0153916_11956716Not Available657Open in IMG/M
3300013086|Ga0163202_1004132All Organisms → cellular organisms → Bacteria2732Open in IMG/M
3300013089|Ga0163203_1001920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi5856Open in IMG/M
(restricted) 3300013127|Ga0172365_10072565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia2232Open in IMG/M
(restricted) 3300013128|Ga0172366_10531855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi702Open in IMG/M
(restricted) 3300013128|Ga0172366_10693407All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia598Open in IMG/M
3300015370|Ga0180009_10171667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1012Open in IMG/M
3300015370|Ga0180009_10323814Not Available634Open in IMG/M
3300017963|Ga0180437_10007831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia13782Open in IMG/M
3300017963|Ga0180437_10453298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium951Open in IMG/M
3300017963|Ga0180437_10732927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia715Open in IMG/M
3300017963|Ga0180437_10746887All Organisms → cellular organisms → Bacteria708Open in IMG/M
3300017971|Ga0180438_10413014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1020Open in IMG/M
3300017989|Ga0180432_10224073All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300020074|Ga0194113_10113435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia2337Open in IMG/M
3300020083|Ga0194111_10898993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi526Open in IMG/M
3300020814|Ga0214088_1388637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1865Open in IMG/M
3300020814|Ga0214088_1431030Not Available862Open in IMG/M
3300021603|Ga0226659_10327629Not Available682Open in IMG/M
3300022221|Ga0224506_10028855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi2906Open in IMG/M
3300022221|Ga0224506_10381841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi623Open in IMG/M
3300022223|Ga0224501_10148247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1348Open in IMG/M
3300022551|Ga0212089_10235488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi885Open in IMG/M
3300022553|Ga0212124_10002096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia16318Open in IMG/M
3300022553|Ga0212124_10030218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi3359Open in IMG/M
3300022553|Ga0212124_10049544All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2489Open in IMG/M
3300024263|Ga0209978_10001511All Organisms → cellular organisms → Bacteria9941Open in IMG/M
3300024263|Ga0209978_10003318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi7232Open in IMG/M
3300024263|Ga0209978_10004026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi6661Open in IMG/M
3300024263|Ga0209978_10015631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi3670Open in IMG/M
3300024263|Ga0209978_10017234All Organisms → cellular organisms → Bacteria3502Open in IMG/M
3300024263|Ga0209978_10328733All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi757Open in IMG/M
3300024263|Ga0209978_10459021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium614Open in IMG/M
3300024353|Ga0209979_1079033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1422Open in IMG/M
3300024353|Ga0209979_1091579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1273Open in IMG/M
3300024353|Ga0209979_1170246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi793Open in IMG/M
3300024429|Ga0209991_10130200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1255Open in IMG/M
3300024429|Ga0209991_10242760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi878Open in IMG/M
3300024429|Ga0209991_10481325Not Available567Open in IMG/M
3300024433|Ga0209986_10000066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia87830Open in IMG/M
3300024433|Ga0209986_10157769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1168Open in IMG/M
3300024433|Ga0209986_10541226Not Available506Open in IMG/M
3300025309|Ga0209212_1210464All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300025313|Ga0209431_11253585Not Available503Open in IMG/M
3300025326|Ga0209342_10355235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1256Open in IMG/M
3300025824|Ga0208325_1153656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia522Open in IMG/M
3300027051|Ga0209269_1000098All Organisms → cellular organisms → Bacteria146121Open in IMG/M
3300027323|Ga0209426_1003248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides6425Open in IMG/M
3300027690|Ga0209164_1169289Not Available763Open in IMG/M
3300027740|Ga0214474_1245383All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium644Open in IMG/M
3300027888|Ga0209635_10150516Not Available1905Open in IMG/M
3300027888|Ga0209635_10163010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides1822Open in IMG/M
3300027888|Ga0209635_10865132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium641Open in IMG/M
3300027893|Ga0209636_10299136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1418Open in IMG/M
3300027893|Ga0209636_10426930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1119Open in IMG/M
3300027893|Ga0209636_11229354All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia525Open in IMG/M
3300027893|Ga0209636_11251051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium518Open in IMG/M
3300027901|Ga0209427_10006569All Organisms → cellular organisms → Bacteria13250Open in IMG/M
3300027917|Ga0209536_101741768Not Available753Open in IMG/M
3300028156|Ga0268281_1111682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium617Open in IMG/M
3300028161|Ga0265596_1030034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1644Open in IMG/M
3300029693|Ga0257137_1039189Not Available796Open in IMG/M
3300029799|Ga0311022_12665047Not Available1093Open in IMG/M
3300030714|Ga0307925_130762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium579Open in IMG/M
3300031257|Ga0315555_1014376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas → Dehalogenimonas formicexedens4796Open in IMG/M
3300031257|Ga0315555_1108362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1258Open in IMG/M
3300031365|Ga0307443_1009624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi4274Open in IMG/M
3300031539|Ga0307380_10204971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1901Open in IMG/M
3300031551|Ga0315548_1045271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2094Open in IMG/M
3300031566|Ga0307378_10602213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia964Open in IMG/M
3300031566|Ga0307378_11083061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalogenimonas645Open in IMG/M
(restricted) 3300031587|Ga0315308_1080074Not Available1382Open in IMG/M
(restricted) 3300031593|Ga0315307_1025137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2406Open in IMG/M
(restricted) 3300031604|Ga0315309_1089649All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1335Open in IMG/M
3300031624|Ga0315545_1071669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1694Open in IMG/M
3300031707|Ga0315291_11096292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi661Open in IMG/M
3300031862|Ga0315280_10004985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia19256Open in IMG/M
3300031862|Ga0315280_10010283All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia11773Open in IMG/M
3300031862|Ga0315280_10014316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia9272Open in IMG/M
3300031862|Ga0315280_10028760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi5511Open in IMG/M
3300031862|Ga0315280_10211489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1086Open in IMG/M
3300031862|Ga0315280_10408370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi623Open in IMG/M
(restricted) 3300031876|Ga0315310_10246575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi776Open in IMG/M
(restricted) 3300031877|Ga0315314_1075575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1500Open in IMG/M
(restricted) 3300031898|Ga0315312_1020784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia3033Open in IMG/M
3300031999|Ga0315274_10004942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi19558Open in IMG/M
3300031999|Ga0315274_10332787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1795Open in IMG/M
3300032020|Ga0315296_10000215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia54588Open in IMG/M
3300032020|Ga0315296_10002711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia14968Open in IMG/M
3300032020|Ga0315296_10013991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia5938Open in IMG/M
3300032020|Ga0315296_10014186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → Dehalococcoidales → Dehalococcoidaceae → Dehalococcoides → Dehalococcoides mccartyi5890Open in IMG/M
3300032020|Ga0315296_10171042All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1322Open in IMG/M
3300032046|Ga0315289_10352918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1490Open in IMG/M
3300032118|Ga0315277_11276255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia646Open in IMG/M
3300033486|Ga0316624_10427705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1115Open in IMG/M
3300033487|Ga0316630_10479035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1014Open in IMG/M
3300033513|Ga0316628_101081949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia1066Open in IMG/M
3300033991|Ga0334965_0005086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia8171Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface23.53%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment15.29%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment7.65%
Sediment, IntertidalEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal4.71%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine4.12%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.53%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment3.53%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment2.35%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands2.35%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment2.35%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment2.35%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.35%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.76%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment1.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.76%
Granular SludgeEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge1.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.18%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment1.18%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland1.18%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.18%
Marine SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment1.18%
Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal FluidEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal Fluid1.18%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water1.18%
Brackish WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water1.18%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater1.18%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.18%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture1.18%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.59%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.59%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.59%
Hot Spring Microbial MatEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat0.59%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.59%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.59%
Deep Subsurface AquiferEnvironmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer0.59%
Anaerobic Digester DigestateEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate0.59%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001687Deep Marine Sediments WOR-3-8_10EnvironmentalOpen in IMG/M
3300001751Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32EnvironmentalOpen in IMG/M
3300001782Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samplesEnvironmentalOpen in IMG/M
3300002052Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30EnvironmentalOpen in IMG/M
3300002053Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZEnvironmentalOpen in IMG/M
3300002481Deep oceanic, basalt-hosted subsurface ecosystem from Juan de Fuca Ridge flank, Pacific Ocean, CORK Borehole 1362A_J2.573EnvironmentalOpen in IMG/M
3300005645Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m)EnvironmentalOpen in IMG/M
3300005782Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3EnvironmentalOpen in IMG/M
3300005822Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 25 cmbsf, MM1EnvironmentalOpen in IMG/M
3300007351Combined Assembly of Gp0115775, Gp0115815EnvironmentalOpen in IMG/M
3300008516Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf. Combined Assembly of MM3PM3EnvironmentalOpen in IMG/M
3300009009Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009034Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, KoreaEnvironmentalOpen in IMG/M
3300009127Combined Assembly of Gp0137036, Gp0137038EnvironmentalOpen in IMG/M
3300009136Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 82 cmbsfEnvironmentalOpen in IMG/M
3300009150Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaGEnvironmentalOpen in IMG/M
3300009311Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009499Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaGEnvironmentalOpen in IMG/M
3300009528Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaGEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009874Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC1TEnvironmentalOpen in IMG/M
3300010284Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaGEnvironmentalOpen in IMG/M
3300010324Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaGEnvironmentalOpen in IMG/M
3300010328Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaGEnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300010995ECM14MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300010996ELM11109_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013086Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_300mEnvironmentalOpen in IMG/M
3300013089Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330mEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300015370Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - OS_PC_MetaGEnvironmentalOpen in IMG/M
3300017963Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaGEnvironmentalOpen in IMG/M
3300017971Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaGEnvironmentalOpen in IMG/M
3300017989Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_MS_2 metaGEnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020814Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahitEngineeredOpen in IMG/M
3300021603Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spadesEngineeredOpen in IMG/M
3300022221Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022223Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_8_1EnvironmentalOpen in IMG/M
3300022551Boni_combined assemblyEnvironmentalOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300024263Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024353Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024429Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025309Soil microbial communities from Rifle, Colorado, USA - Groundwater C2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025824Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m (SPAdes)EnvironmentalOpen in IMG/M
3300027051Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027323Deep oceanic, basalt-hosted subsurface ecosystem from Juan de Fuca Ridge flank, Pacific Ocean, CORK Borehole 1362B_J2.571 (SPAdes)EnvironmentalOpen in IMG/M
3300027690Enrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027740Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 HiSeqEnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027893Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)EnvironmentalOpen in IMG/M
3300027901Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-36_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300028156Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_50mEnvironmentalOpen in IMG/M
3300028161Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_60mEnvironmentalOpen in IMG/M
3300029693Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_50m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029799Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119EngineeredOpen in IMG/M
3300030714Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - UN-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031257Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-80EnvironmentalOpen in IMG/M
3300031365Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1601-220EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031551Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031587 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3EnvironmentalOpen in IMG/M
3300031593 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2EnvironmentalOpen in IMG/M
3300031604 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4EnvironmentalOpen in IMG/M
3300031624Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-10EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031876 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5EnvironmentalOpen in IMG/M
3300031877 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9EnvironmentalOpen in IMG/M
3300031898 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032020Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033991Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bactEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
WOR8_10011666103300001687Marine SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLTAILFA*
JGI2172J19969_1003485833300001751Marine SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLMAILFA*
JGI2172J19969_1005342133300001751Marine SedimentMEQQGIPLSISIIIAAAVLGATFIIGMVLFAVLSAM*
WOR52_1002471343300001782Marine SedimentMGDNGIPLSIGIIIAAAVLGAAFIAGMVLLAILFA*
SMTZ1_10009759153300002052Marine SedimentMGEEGIPLSISIIISASVLGATFVSGMVLLAILFG*
SMTZ23_1003408783300002053Marine SedimentMGDNGIPLSIGIIIAAAVLGAAFIAGMVLLAVLFA*
JGI24020J35080_101617843300002481Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal FluidMGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFASGGNLG
Ga0077109_100070193300005645Brackish WaterMGQEGIPLSIGIIIAAAILGATFIAGMVLLAILFV*
Ga0077109_106334723300005645Brackish WaterMGQDGFPLAIGIIIAAAVLGAAFIAGLVLLAVLAI*
Ga0079367_103935033300005782Marine SedimentMGQDGIPLSIGIIIAAAILGATFIAGMVLLAILFV*
Ga0078744_103267433300005822Marine SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLMAVLSA*
Ga0104751_122377913300007351Deep Subsurface AquiferMQDGIPLSLGIIIAAAILGTTFVLGMVLLAILGA*
Ga0111033_110052843300008516Marine SedimentMGQEGIPLSIGIIIAAAILGVAFVAGMVLSAVLAAI*
Ga0111033_123302953300008516Marine SedimentLKEVIMGENGIPLSIGIIIAAAVLGAAFIAGMVLLAVLFA*
Ga0105105_1032402333300009009Freshwater SedimentMGENGLPLSVGIIIAAAVLGVLLIAGLVLLAILGA*
Ga0115863_1004915123300009034Sediment, IntertidalMGQDGIPLSIGIIIAAGILGATFIAGMVLLAILLSVV*
Ga0115863_103270973300009034Sediment, IntertidalMQQQQDGIPLSIGIIIAAVVLGAAFIAGMVLLAILLV*
Ga0115863_103463673300009034Sediment, IntertidalMGQDEIPISIGIIIAAAILGATFILGMVLMAVLSA*
Ga0115863_103763823300009034Sediment, IntertidalMGQDGIPLSIGIIVAAAILGATFVAGMVLVAVLSI*
Ga0115863_153551933300009034Sediment, IntertidalMGQEGIPLSIGIIIAAGILGATFIAGMVLLAILFST*
Ga0115863_160934413300009034Sediment, IntertidalMEQDGIPLSIGIIIAAAVLGATFIAGMVLFAVLSAM*
Ga0115863_164145733300009034Sediment, IntertidalMGQDGIPLSIGIIIAAAILGATFIAGMVLLAILFA*
Ga0115863_168387523300009034Sediment, IntertidalMGQDGIPISIGIIIAAAILGATFIAGVVLMAILFV*
Ga0118724_1000719313300009127MarineMGQDGIPLSIGVIIAAAILGATFIMGMVLSAVLGA*
Ga0118724_102641263300009127MarineMGQDGIPLSIGIIIAAAILGATFIVGMVLLAVLIA*
Ga0118724_108687533300009127MarineMGQDGIPLSIGIIIAAAILGATFIAGMVLMAVLSNT*
Ga0118724_113332533300009127MarineMGQDGIPLSIGIIIAAAVLGATFIAGMVLLAVLSA*
Ga0118724_127829723300009127MarineMGQDGDGIPLSIGIIIAAAILGATFIVGMVLMAVLSV*
Ga0118724_129429423300009127MarineMEQQGIPLSIGIIIAAAVLGATFIAGVVLMAILSV*
Ga0118735_1000186993300009136Marine SedimentMQQQQNGIPLSIGIIIAAAILGATFISGMVLLAILLAW*
Ga0118735_1016758923300009136Marine SedimentMEQNGIPLSLGIIIAAAILGATFITGMVLLAILFG*
Ga0118735_1033864723300009136Marine SedimentMEQDGIPISIGIIIAAAILGATFVAGMVLMAILFV*
Ga0114921_1000347673300009150Deep SubsurfaceMEQDGIPLSIGIIIAAGILGATFIAGMVLLAILLSVV*
Ga0114921_1000461043300009150Deep SubsurfaceMGQDGIPISIGIIIAATILGATFIIGMILLAVLSA*
Ga0114921_1002262323300009150Deep SubsurfaceMGQEGIPLSLGIIIGTAILGATFIMGMVLMAVLGA*
Ga0114921_1004113753300009150Deep SubsurfaceMEQNGIPLSIGIIIGAAVLGVTFIAGMVLMAILFA*
Ga0114921_1009793343300009150Deep SubsurfaceMGQNGIPLSIGIIIASAILGVMFVGGMVLLAVLST*
Ga0114921_1020423823300009150Deep SubsurfaceMEQNGIPLSIGIVIGAAILGVMFVCGMVLMAVLSA*
Ga0114921_1021604123300009150Deep SubsurfaceMGQDGIPLSIGIIIAAAILGATFVAGMVLMAILSA*
Ga0114921_1041391433300009150Deep SubsurfaceMGEDGIPISIGIIIAAAILGATFVAGVVLMAILFA*
Ga0114921_1042352223300009150Deep SubsurfaceMEQNGIPLSIGIVIGAAILGVMFVCGMVLMAVLFT*
Ga0114921_1097092023300009150Deep SubsurfaceMEQNGIPLSIGIIIAAAILGVTFVAGVVVMAILLA*
Ga0117906_110506233300009311MarineMGQEGIPLSIGLIIGAAILGAALVAGLVIMAVVGAFS*
Ga0114925_1005753853300009488Deep SubsurfaceMEQDGIPLSIGIIIAAAILGATFIAGMVLLAILLSA*
Ga0114925_1115564523300009488Deep SubsurfaceMEQDGIPLSIGIIIAAVILGAAFVVGMVLMAVLSA*
Ga0114930_1003408843300009499Deep SubsurfaceMQQQQDGIPLSIGIIIAAAVLGAAFIAGMVLLAILLA*
Ga0114920_1005014033300009528Deep SubsurfaceMGQDGIPISIGIIIAATILGATFIIGMILLAILSA*
Ga0114920_1008190413300009528Deep SubsurfaceMTQNGIPLSIGIIIAAVILGATFIAGVVLMAILFAQV*
Ga0114920_1013924433300009528Deep SubsurfaceMGQNGIPLSIGIIIASAILGVMFVGGMVPLAVLST*
Ga0114920_1037251523300009528Deep SubsurfaceMEQNGIPLSIGIIIGAAVLGVTFIAGMVLMAILLA*
Ga0114920_1064488133300009528Deep SubsurfaceMGQDGIPLSIGIIIAAAILGVTFIAGMVLLAILFV*
Ga0114920_1081448723300009528Deep SubsurfaceMGQNGIPLSIGVIIAAAILGATFVVGMVLMAVLSA*
Ga0114920_1087926233300009528Deep SubsurfaceMGQDGIPLSIGIIIAAAILGVMFVAGMVLMAILSV*
Ga0114920_1105667123300009528Deep SubsurfaceMEEGIPLSIGIIIAAAILGVTFVAGMVLLAVLFV*
Ga0114919_1004475323300009529Deep SubsurfaceMGQDGIPISIGIIIAAVILGACFVMGMVLMAILFA*
Ga0114919_1021205613300009529Deep SubsurfaceMGQDGIPISIGIIIAAAILGVTFVAGMVLMAILFT*
Ga0114919_1026662123300009529Deep SubsurfaceMRQDGIPISIGIIIAAAILGATFIAGVVLMAILFT*
Ga0129287_1050104313300009538Beach Aquifer PorewaterMEQQGIPLSIGIIIAAAVIGATFIAGMALMAILSALK*
Ga0129287_1052757213300009538Beach Aquifer PorewaterMEQQGLPVSISIIIAAAVIGVMFAAGMVLLAVLSSK*
Ga0131789_1005734733300009874SedimentKGVIMGENGIPISVGIIIGAAILGAMTIAGMILMAIIGGAIG*
Ga0129301_100083823300010284Hot Spring Microbial MatMQDGIPLSLGIIVAAAILGATFVLGMVLMAVLFP*
Ga0129297_1018251833300010324Lake SedimentMGPDGIPVSIGIIIAAAILGASFVLGMVLMAILFA*
Ga0129297_1054192923300010324Lake SedimentMGQDGIPLSLGIIIAAAILGATFVLGMVLMAVLSA*
Ga0129298_1003659143300010328Lake SedimentMGQDGIPVSIGIIIAAAILGASFVLGMVLMAILFA*
Ga0136851_1018545753300010413Mangrove SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLMAVLTA*
Ga0139323_14651523300010995SedimentMGQDGIPLSISIIIAAAVLGATFIIGMLLFAVLSAA*
Ga0139308_11642423300010996SedimentMNQEGIPLSIGIIVAASVLGAAFIAGMVLLAVLFA*
Ga0151652_1121861223300011340WetlandMGENGLPLSVGIIIAAAVLGVLVIVGMVLAAILGA*
Ga0151652_1285691923300011340WetlandMGENSLPLSVGIIIAAAVLGVLVIVGLVLLAILGA*
Ga0153915_1318485823300012931Freshwater WetlandsMNQDGIPLSLGVVIAAAILGAFIVAGMVIFAVISII*
Ga0153916_1125370923300012964Freshwater WetlandsMGQDGIPISITIIVAAAILGAAFIAGMVLLAVLFP*
Ga0153916_1166847133300012964Freshwater WetlandsMGQDGIPVSIGIIIAAAILGACFVLGMVLMAILFA*
Ga0153916_1195671623300012964Freshwater WetlandsMNQDGIPMSLAAIIAAAILGAAFVAGMVLLAVLFG*
Ga0163202_100413223300013086FreshwaterMGQDGIPISIGIIIAAAILGACFVLGMVLLAILFA*
Ga0163203_100192053300013089FreshwaterMGDNGIPLSIGIIIAAAVLGATFIAGMVLLAVLFG*
(restricted) Ga0172365_1007256523300013127SedimentMNQDGIPLSIGIIIAAVVLGAAFVAGMVLLAVLFV*
(restricted) Ga0172366_1053185523300013128SedimentMGQDGIPLSIGIIIAAAILGATFIIGMVMLAILSA*
(restricted) Ga0172366_1069340723300013128SedimentMMGDNGVPLSIGIIIAAAILGAAFIAGMVLLAVLFT*
Ga0180009_1017166733300015370GroundwaterMGQDGIPLSIGIIIAAAILGVTFVAGMVLMAILSA*
Ga0180009_1032381413300015370GroundwaterMGQNGIPIAITIIVAAAILGATFIVGMVLMAVLFT*
Ga0180437_10007831153300017963Hypersaline Lake SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLMAILFA
Ga0180437_1045329823300017963Hypersaline Lake SedimentMGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFA
Ga0180437_1073292723300017963Hypersaline Lake SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLMAILFT
Ga0180437_1074688723300017963Hypersaline Lake SedimentMGENGIPLSIGLIVAAAILGATFVIGMVLMAVLFA
Ga0180438_1041301433300017971Hypersaline Lake SedimentMGQEGIPLAIGVIVGAAILGVMIVAGFVLLAILST
Ga0180432_1022407323300017989Hypersaline Lake SedimentMGQDGIPLSIGLVIAAAILGVAFVAGMVLMAVLFV
Ga0194113_1011343533300020074Freshwater LakeMGQDGIPISIGIIIAAAILGACFVLGMVLMAVLFT
Ga0194111_1089899323300020083Freshwater LakeMEQGGIPLSLGIIVAAAILGATFVLGMILMAVLSI
Ga0214088_138863753300020814Granular SludgeMGDNGIPVTMGVIIAAAVLGAMIIAGLVLLAVFLV
Ga0214088_143103023300020814Granular SludgeMNQEGIPLSLGVVMAAAILGAFIVAGMVIFAVFSII
Ga0226659_1032762923300021603Granular SludgeMNQEGIPLSLGVVIAAAILGAFIVAGMVIFAVFSII
Ga0224506_1002885543300022221SedimentMGDNGIPLSIGIIIAAAILGATFIAGMVLLAVLLQLTAL
Ga0224506_1038184123300022221SedimentMEQEGIPLSIGIIIAAAILGATFIAGMVLLAVLFT
Ga0224501_1014824723300022223SedimentMGDNGIPLSIGIIIAAAILGATFIAGMVLLAVLFS
Ga0212089_1023548823300022551Lake SedimentMGQDGIPVSIGIIIAAAILGASFVLGMVLMAILFA
Ga0212124_10002096123300022553FreshwaterMGQDGIPISIGIIIAAAILGACFVLGMVLLAILFA
Ga0212124_1003021853300022553FreshwaterEQDGMPLSIGIIIAAAILGATFIAGMVLLAVLFGA
Ga0212124_1004954413300022553FreshwaterMGDNGIPLSIGIIIAAAVLGATFIAGMVLLAVLFG
Ga0209978_1000151123300024263Deep SubsurfaceMEQNGIPLSIGIVIGAAILGVMFVCGMVLMAVLFT
Ga0209978_1000331823300024263Deep SubsurfaceMGQDGIPISIGIIIAAAILGATFIAGVVLMAILFV
Ga0209978_1000402623300024263Deep SubsurfaceMEQNGIPLSIGIVIGAAILGVMFVCGMVLMAVLSA
Ga0209978_1001563163300024263Deep SubsurfaceMGQDGIPISIGIIIAATILGATFIIGMILLAVLSA
Ga0209978_1001723423300024263Deep SubsurfaceMEQDGIPLSIGIIIAAGILGATFIAGMVLLAILLSVV
Ga0209978_1032873323300024263Deep SubsurfaceMGQDGIPLSIGIIIAAAILGATFVAGMVLMAILSA
Ga0209978_1045902133300024263Deep SubsurfaceMEQNGIPLSIGIIIGAAVLGVTFIAGMVLMAILFA
Ga0209979_107903333300024353Deep SubsurfaceMQQQQDGIPLSIGIIIAAAVLGAAFIAGMVLLAILLA
Ga0209979_109157933300024353Deep SubsurfaceMGQDGIPLSIGIIIAAGILGATFIAGMVLLAILLSVV
Ga0209979_117024623300024353Deep SubsurfaceMGQDGIPLSIGIIIAAAILGATFIAGMVLLAILFV
Ga0209991_1013020013300024429Deep SubsurfaceMGQDGIPLSIGIIIAAAILGVMFVAGMVLMAILSV
Ga0209991_1024276033300024429Deep SubsurfaceMGQDGIPISIGIIIAATILGATFIIGMILLAILSA
Ga0209991_1048132523300024429Deep SubsurfaceMGQEGIPLSLGVIIAAAILGATFVAGLVLMAVLLG
Ga0209986_10000066883300024433Deep SubsurfaceMGDNGIPLSIGIIIAAAVLGATFIAGMVLLAILSA
Ga0209986_1015776933300024433Deep SubsurfaceMGQDGIPLSIGIIIGAAILGVMFVGGMVLVAILFT
Ga0209986_1054122623300024433Deep SubsurfaceGVIMGQDGIPISIGIIIAAAILGATFIAGVVLMAILFT
Ga0209212_121046413300025309SoilMQDGIPLSIGIIIVAALLGATFIAGVVVFSVLSAAF
Ga0209431_1125358523300025313SoilMQDGIPLSIGIIIAAAVLGATFIAGMVVFAVLSAPF
Ga0209342_1035523513300025326SoilPVSIGIIIAAAILGAVLGGAFIVGMAVQAVLGAGQ
Ga0208325_115365633300025824FreshwaterMGQDGIPLSIGIIIAAAILGATFIVGMVLLAVLIA
Ga0209269_100009843300027051Enrichment CultureMGQEGIPISISIIVAAAILGAMFFIVGMALVLVLAG
Ga0209426_100324843300027323Deep Oceanic, Basalt-Hosted Subsurface Hydrothermal FluidMGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFASG
Ga0209164_116928923300027690Enrichment CultureMGQDGIPVSIGMIIAAAILGACFVLGMVLMAVLFT
Ga0214474_124538323300027740SoilMAQEGIPLSIGIIIGAAILGVTFIAGMVLLAVLFT
Ga0209635_1015051623300027888Marine SedimentMGENGIPLSIGLIVAAAILGATFIIGMVLMAVLFA
Ga0209635_1016301043300027888Marine SedimentMEQQGIPLSISIIIAAAVLGATFIIGMVLFAVLSAM
Ga0209635_1086513223300027888Marine SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLMAVLFA
Ga0209636_1029913633300027893Marine SedimentMGQDGIPLSIGIIIAAGILGATFIVGMILLAILFA
Ga0209636_1042693023300027893Marine SedimentMGQNGIPLSIGIIIAAAILGVTFVAGMVLMAILSI
Ga0209636_1122935423300027893Marine SedimentMEQDGIPLSLGIIIGAAILGATFIAGMVLFAILSGL
Ga0209636_1125105123300027893Marine SedimentMGDNGIPLSIGIIIAAAVLGAAFIAGMVLLAILFA
Ga0209427_1000656993300027901Marine SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLTAILFA
Ga0209536_10174176833300027917Marine SedimentMGQDGIPLSIGVIIAAAVLGTVLVGGMVLLAIIMIS
Ga0268281_111168233300028156Saline WaterMGQDGFPLAIGIIIAAAVLGAAFIAGLVLLAVLAI
Ga0265596_103003433300028161Saline WaterMGQEGIPLSIGIIIAAAILGATFIAGMVLLAILFV
Ga0257137_103918913300029693MarineVMGQDGFPLAIGIIIAAAVLGAASIAGLVLLAVLAI
Ga0311022_1266504723300029799Anaerobic Digester DigestateMNQEGIPLSLGVVIAAAILGALIVAGMVIFAVFSII
Ga0307925_13076213300030714SoilMGQDGIPISIGIIIAAAILGACFVLGMVLMAVLSA
Ga0315555_101437643300031257Salt Marsh SedimentMEDNGIPLSIGIIIAAAVLGAAFIAGMVLLAILLA
Ga0315555_110836223300031257Salt Marsh SedimentMGDNGIPLSIGIIIAAAVLGATFIAGMVLLAVLLG
Ga0307443_100962413300031365Salt MarshMGDNGIPLAIGIIIAAAVLGAAFIAGMVLLAILLA
Ga0307380_1020497133300031539SoilMGEEGIPLSISLIIAASILGATFVIGMVLLAILSG
Ga0315548_104527123300031551Salt Marsh SedimentMEQDGIPLSIGIIIGAAILGATFIAGMVLFAVLSTL
Ga0307378_1060221323300031566SoilMGQDGFPLAIGIIIAATVLGATFIAGMVLLAVLFG
Ga0307378_1108306133300031566SoilMGQDSFPLAIGIIIAAAILGATFIAGMVLLAVLAL
(restricted) Ga0315308_108007433300031587SedimentMGQDGIPLSLGIIIAAAILGAIFVLGVLLMAVLSA
(restricted) Ga0315307_102513763300031593SedimentMGQDGIPLSLGIIIAAAILGAIFVLGVVLMAVLSA
(restricted) Ga0315309_108964923300031604SedimentMGQDGIPLSLGIIIAAAILGATFVLGMVLMAVLSA
Ga0315545_107166933300031624Salt Marsh SedimentMEDGIPLSIGIIIGAAILGATFIAGMVLFAVLSAM
Ga0315291_1109629223300031707SedimentMGQDGIPVSIGIIIAAAILGACFVLGMVLMAILFA
Ga0315280_10004985163300031862SedimentMGQEGLPISLAIIVAATILGAAFIAGMVLLAVLFT
Ga0315280_10010283123300031862SedimentMNQEGIPLSIGIIVAAAVLGATFIAGMVLLAVLFG
Ga0315280_1001431653300031862SedimentMEQNGVPLSIGIIIAAAILGATFIAGMVLLAVLFT
Ga0315280_1002876023300031862SedimentMGENGIPLSLGIIIAAAVLGATFIAGMVLLAVLFS
Ga0315280_1021148933300031862SedimentMGQDGIPISITIIVAAAILGAAFIAGMVLLAVLFT
Ga0315280_1040837023300031862SedimentMGDNGIPLSIAIIIAAAILGATFVAGMVLLAVLFT
(restricted) Ga0315310_1024657523300031876SedimentMEQDGIPLSLGIIIAAAILGATFVLGMVLMAVLSA
(restricted) Ga0315314_107557533300031877SedimentMGQDGIPISIGIIIAAAILGACFVLGMVLMAVILA
(restricted) Ga0315312_102078433300031898SedimentMGQEGIPLSLGVIIAAAVLGAIVVLGMVLLAVLSA
Ga0315274_10004942173300031999SedimentMGQDGIPISVVIIIATAILGVCFVMSMVLIAVFFS
Ga0315274_1033278733300031999SedimentMAQEGIPLSIGIIIGAAILGVTFIAGMVLMAVLFT
Ga0315296_10000215213300032020SedimentMGDNGIPLSIGIIIAAAILGATFIVGMVLLAVLFT
Ga0315296_1000271193300032020SedimentMGQDGIPISVVIIIATAILGACFVWGMVLMAIILA
Ga0315296_1001399143300032020SedimentMGDNGIPLSIGIIIAAAILGATFIAGMVLLAVLFT
Ga0315296_1001418673300032020SedimentMGQDGIPISLAIIIAAAILGATFVAGMVLLALLFT
Ga0315296_1017104233300032020SedimentMGDNGIPLSIGIIIAAAILGAMFVAGMVLLAVLFT
Ga0315289_1035291813300032046SedimentMGQDGIPISITIIVAAAILGATFIAGMVLLAVLFT
Ga0315277_1127625513300032118SedimentMAQEGIPLSIGIIIGAAILGFTFIAGMVLLAVLFT
Ga0316624_1042770523300033486SoilMNQDGIPLSLGVIIAAAIMGAFIVAGMVIFAVFSII
Ga0316630_1047903523300033487SoilMNQDGIPLSLGVVIAAAILGAFIVAGMVIFAVFSII
Ga0316628_10108194923300033513SoilMNQDGIPLSLGVVIAAAILGAFIVTGMVIFAVFSMI
Ga0334965_0005086_7603_77103300033991SedimentMGQDGVPLSIGIIIAAAILGATFIAGMVLLAILFG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.