NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F034583

Metagenome / Metatranscriptome Family F034583

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F034583
Family Type Metagenome / Metatranscriptome
Number of Sequences 174
Average Sequence Length 67 residues
Representative Sequence LDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Number of Associated Samples 157
Number of Associated Scaffolds 174

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 83.33 %
% of genes from short scaffolds (< 2000 bps) 89.08 %
Associated GOLD sequencing projects 155
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (52.299 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(13.218 % of family members)
Environment Ontology (ENVO) Unclassified
(33.908 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(53.448 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 41.79%    β-sheet: 0.00%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 174 Family Scaffolds
PF00137ATP-synt_C 66.67
PF00416Ribosomal_S13 21.84
PF01479S4 4.60
PF00411Ribosomal_S11 2.30
PF00253Ribosomal_S14 1.15
PF00662Proton_antipo_N 0.57
PF03947Ribosomal_L2_C 0.57
PF00347Ribosomal_L6 0.57

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 174 Family Scaffolds
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 66.67
COG0099Ribosomal protein S13Translation, ribosomal structure and biogenesis [J] 21.84
COG0100Ribosomal protein S11Translation, ribosomal structure and biogenesis [J] 2.30
COG0199Ribosomal protein S14Translation, ribosomal structure and biogenesis [J] 1.15
COG1009Membrane H+-translocase/NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunitEnergy production and conversion [C] 1.15
COG0090Ribosomal protein L2Translation, ribosomal structure and biogenesis [J] 0.57
COG0097Ribosomal protein L6P/L9ETranslation, ribosomal structure and biogenesis [J] 0.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms65.52 %
UnclassifiedrootN/A34.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002408|B570J29032_109517744All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300002674|Ga0005252J37289_103543All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127641Open in IMG/M
3300002835|B570J40625_100291587All Organisms → cellular organisms → Bacteria1661Open in IMG/M
3300003303|Ga0006246J48908_1016040All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127613Open in IMG/M
3300003681|Ga0008457_1012652All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127656Open in IMG/M
3300003684|Ga0005851_1009333Not Available766Open in IMG/M
3300003754|Ga0005853_1013079All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127635Open in IMG/M
3300004054|Ga0063232_10013333All Organisms → cellular organisms → Bacteria1847Open in IMG/M
3300004762|Ga0007749_1204811All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127553Open in IMG/M
3300004764|Ga0007754_1014506All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300004764|Ga0007754_1466949Not Available735Open in IMG/M
3300004767|Ga0007750_1017987Not Available1041Open in IMG/M
3300004767|Ga0007750_1021232All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127619Open in IMG/M
3300004768|Ga0007762_1670774All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127642Open in IMG/M
3300004784|Ga0007744_1247291All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127623Open in IMG/M
3300004786|Ga0007753_1490050All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127662Open in IMG/M
3300004789|Ga0007752_11223811All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127609Open in IMG/M
3300004792|Ga0007761_10157255All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127511Open in IMG/M
3300004794|Ga0007751_10127482All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127735Open in IMG/M
3300004797|Ga0007764_10062500All Organisms → cellular organisms → Bacteria3443Open in IMG/M
3300004836|Ga0007759_10126861All Organisms → cellular organisms → Bacteria2405Open in IMG/M
3300005418|Ga0068881_1032889All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127618Open in IMG/M
3300005420|Ga0068879_1736399All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127765Open in IMG/M
3300005565|Ga0068885_1947752All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127631Open in IMG/M
3300006374|Ga0075512_1318568All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127631Open in IMG/M
3300006382|Ga0075494_1362237All Organisms → cellular organisms → Bacteria → Proteobacteria822Open in IMG/M
3300006384|Ga0075516_1433077All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300006393|Ga0075517_1001597All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300006393|Ga0075517_1003331All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127599Open in IMG/M
3300006396|Ga0075493_1007663Not Available3192Open in IMG/M
3300006728|Ga0031676_1398645All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127658Open in IMG/M
3300006728|Ga0031676_1408364All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127612Open in IMG/M
3300006803|Ga0075467_10000617Not Available28785Open in IMG/M
3300008117|Ga0114351_1068896Not Available2671Open in IMG/M
3300008791|Ga0103696_1026452All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127630Open in IMG/M
3300008915|Ga0103480_102364All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127679Open in IMG/M
3300008921|Ga0103486_1008115All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127693Open in IMG/M
3300008922|Ga0103487_1006335All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300009068|Ga0114973_10060047Not Available2221Open in IMG/M
3300009185|Ga0114971_10762004All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127526Open in IMG/M
3300009187|Ga0114972_10011870Not Available6296Open in IMG/M
3300009357|Ga0103827_1008544Not Available613Open in IMG/M
3300009436|Ga0115008_10261634Not Available1230Open in IMG/M
3300009441|Ga0115007_10358247Not Available951Open in IMG/M
3300009498|Ga0115568_10156333Not Available1081Open in IMG/M
3300009543|Ga0115099_10987922Not Available1521Open in IMG/M
3300009592|Ga0115101_1012565Not Available5820Open in IMG/M
3300009599|Ga0115103_1371840Not Available934Open in IMG/M
3300009608|Ga0115100_10005284Not Available3533Open in IMG/M
3300009608|Ga0115100_10803021All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127565Open in IMG/M
3300009677|Ga0115104_10121375All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127747Open in IMG/M
3300009677|Ga0115104_10299272Not Available867Open in IMG/M
3300009728|Ga0123371_161864All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127664Open in IMG/M
3300009732|Ga0123373_141438All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127527Open in IMG/M
3300009735|Ga0123377_1040638Not Available965Open in IMG/M
3300010404|Ga0129323_1095017Not Available817Open in IMG/M
3300010885|Ga0133913_10542038Not Available3061Open in IMG/M
3300012414|Ga0138264_1513187All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127741Open in IMG/M
3300012416|Ga0138259_1815933All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127621Open in IMG/M
3300012419|Ga0138260_10142495Not Available1686Open in IMG/M
3300012472|Ga0129328_1017087Not Available3625Open in IMG/M
3300012504|Ga0129347_1008688All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127739Open in IMG/M
3300012516|Ga0129325_1065131Not Available922Open in IMG/M
3300012523|Ga0129350_1278793All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300012523|Ga0129350_1399446All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127733Open in IMG/M
3300012524|Ga0129331_1262360Not Available3602Open in IMG/M
3300012525|Ga0129353_1612172All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127735Open in IMG/M
3300012688|Ga0157541_1132578All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127660Open in IMG/M
3300012702|Ga0157596_1153641All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127658Open in IMG/M
3300012705|Ga0157555_1185588Not Available819Open in IMG/M
3300012718|Ga0157557_1073253Not Available927Open in IMG/M
3300012727|Ga0157531_1296196All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127664Open in IMG/M
3300012732|Ga0157549_1183786Not Available826Open in IMG/M
3300012742|Ga0157539_106733Not Available754Open in IMG/M
3300012748|Ga0157553_1020688All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127634Open in IMG/M
3300012751|Ga0138277_1059053Not Available785Open in IMG/M
3300012753|Ga0157548_1034903All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127749Open in IMG/M
3300012754|Ga0138278_1112010All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300012754|Ga0138278_1140193All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300012756|Ga0138272_1113770All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127657Open in IMG/M
3300012758|Ga0138285_1123907All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127638Open in IMG/M
3300012760|Ga0138273_1044159All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127744Open in IMG/M
3300012760|Ga0138273_1052791All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127661Open in IMG/M
3300012761|Ga0138288_1158679Not Available973Open in IMG/M
3300012763|Ga0138289_1173002All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127669Open in IMG/M
3300012763|Ga0138289_1199071Not Available810Open in IMG/M
3300012769|Ga0138279_1025651Not Available757Open in IMG/M
3300012769|Ga0138279_1248126Not Available748Open in IMG/M
3300012771|Ga0138270_1112639All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127752Open in IMG/M
3300012772|Ga0138287_1021277All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127623Open in IMG/M
3300012775|Ga0138280_1017342All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127957Open in IMG/M
3300012775|Ga0138280_1056152Not Available893Open in IMG/M
3300012776|Ga0138275_1265670All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127928Open in IMG/M
3300012785|Ga0157528_117662All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127573Open in IMG/M
3300012935|Ga0138257_1690250All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127627Open in IMG/M
3300012963|Ga0129340_1187621All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127758Open in IMG/M
3300012966|Ga0129341_1157112All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300012969|Ga0129332_1316269Not Available873Open in IMG/M
3300013006|Ga0164294_11060691Not Available544Open in IMG/M
3300013077|Ga0157526_1146211All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127593Open in IMG/M
3300016685|Ga0180050_1095079All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127575Open in IMG/M
3300016695|Ga0180059_1017578All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127628Open in IMG/M
3300016696|Ga0180049_1010314All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127658Open in IMG/M
3300016740|Ga0182096_1146157Not Available972Open in IMG/M
3300016766|Ga0182091_1193665All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127652Open in IMG/M
3300018542|Ga0188841_100516All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300018553|Ga0188840_101102All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300018603|Ga0192881_1003817Not Available1353Open in IMG/M
3300018603|Ga0192881_1007886Not Available1010Open in IMG/M
3300018610|Ga0188884_1006092All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300018619|Ga0188877_1011719All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127752Open in IMG/M
3300018684|Ga0192983_1022524All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127844Open in IMG/M
3300018791|Ga0192950_1013233Not Available1016Open in IMG/M
3300018980|Ga0192961_10030439Not Available1444Open in IMG/M
3300018982|Ga0192947_10253812Not Available564Open in IMG/M
3300019036|Ga0192945_10023390Not Available1517Open in IMG/M
3300019036|Ga0192945_10097169Not Available923Open in IMG/M
3300019045|Ga0193336_10118644All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300019085|Ga0188830_1014514All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127645Open in IMG/M
3300019123|Ga0192980_1020235Not Available1236Open in IMG/M
3300019201|Ga0180032_1140898All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127644Open in IMG/M
3300019207|Ga0180034_1123316All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127547Open in IMG/M
3300019214|Ga0180037_1020462Not Available830Open in IMG/M
3300019261|Ga0182097_1347676All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127661Open in IMG/M
3300020160|Ga0211733_11196982All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127881Open in IMG/M
3300020162|Ga0211735_10430460All Organisms → cellular organisms → Bacteria2168Open in IMG/M
3300021169|Ga0206687_1682237All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127785Open in IMG/M
3300021284|Ga0210299_146558All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127677Open in IMG/M
3300021299|Ga0210302_1083731All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127502Open in IMG/M
3300021303|Ga0210308_1003252All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127642Open in IMG/M
3300021305|Ga0210296_1087618Not Available914Open in IMG/M
3300021305|Ga0210296_1089886All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127573Open in IMG/M
3300021325|Ga0210301_1314820All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127640Open in IMG/M
3300021334|Ga0206696_1630412Not Available904Open in IMG/M
3300021336|Ga0210307_1404270All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127629Open in IMG/M
3300021350|Ga0206692_1303144Not Available902Open in IMG/M
3300021353|Ga0206693_1409348All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127660Open in IMG/M
3300021847|Ga0210305_1094793All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300021847|Ga0210305_1142566All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300021849|Ga0210304_1069732All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127637Open in IMG/M
3300022369|Ga0210310_1007003Not Available1071Open in IMG/M
3300023694|Ga0228683_1017826All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127755Open in IMG/M
3300024480|Ga0255223_1060985All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127645Open in IMG/M
3300024483|Ga0255224_1070047All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127729Open in IMG/M
3300024533|Ga0256299_1085736All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127626Open in IMG/M
3300024549|Ga0256308_1078645All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127697Open in IMG/M
3300024560|Ga0256306_1114886Not Available625Open in IMG/M
3300024567|Ga0256307_1112015Not Available632Open in IMG/M
3300024849|Ga0255230_1055749All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127715Open in IMG/M
3300025570|Ga0208660_1000162Not Available25383Open in IMG/M
3300025880|Ga0209534_10397979Not Available597Open in IMG/M
3300026405|Ga0256296_1034219All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127616Open in IMG/M
3300026415|Ga0256298_1054862All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127545Open in IMG/M
3300026449|Ga0247593_1073689All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127670Open in IMG/M
3300026458|Ga0247578_1102116All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127564Open in IMG/M
3300026465|Ga0247588_1106977All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127560Open in IMG/M
3300026495|Ga0247571_1105641All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127655Open in IMG/M
3300027833|Ga0209092_10222929Not Available1051Open in IMG/M
3300027892|Ga0209550_10099363All Organisms → cellular organisms → Bacteria2178Open in IMG/M
3300028108|Ga0256305_1125260All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127615Open in IMG/M
3300028110|Ga0247584_1002734Not Available3420Open in IMG/M
3300028137|Ga0256412_1117093All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127975Open in IMG/M
3300028282|Ga0256413_1209573All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127698Open in IMG/M
3300028282|Ga0256413_1221425All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127676Open in IMG/M
3300028290|Ga0247572_1133078All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127619Open in IMG/M
3300028329|Ga0210315_1026015All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127741Open in IMG/M
3300028334|Ga0247597_1042864All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127609Open in IMG/M
3300030699|Ga0307398_10739093All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127546Open in IMG/M
3300030721|Ga0308133_1022990Not Available862Open in IMG/M
3300031571|Ga0308141_1054294All Organisms → cellular organisms → Eukaryota → Haptista → Centroplasthelida → Panacanthocystida → Acanthocystida → Marophrys → unclassified Marophrys → Marophrys sp. SRT127722Open in IMG/M
3300031658|Ga0307984_1162300Not Available621Open in IMG/M
3300033978|Ga0334977_0000533Not Available23552Open in IMG/M
3300034019|Ga0334998_0060836All Organisms → cellular organisms → Bacteria2600Open in IMG/M
3300034050|Ga0335023_0000182Not Available38017Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake13.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake12.07%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.92%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.34%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine9.77%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine8.62%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater6.32%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater5.75%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.75%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.45%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.30%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.72%
Bay WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Bay Water1.72%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.15%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.15%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.15%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.57%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.57%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.57%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water0.57%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.57%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.57%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.57%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.57%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002674Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003303Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome C0912_C33A6_35 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003681Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_48_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003684Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003754Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004762Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004764Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004767Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004768Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004784Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004786Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004794Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004797Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005418Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005565Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006382Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006728Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2967 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008791Microbial communities from seawater in eastern North Pacific Ocean - P1 free-living McLaneEnvironmentalOpen in IMG/M
3300008915Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - KA1EnvironmentalOpen in IMG/M
3300008921Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB1EnvironmentalOpen in IMG/M
3300008922Microbial communities of nutrient treated water from Blanes Bay, Barcelona, Spain - NB2EnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009187Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaGEnvironmentalOpen in IMG/M
3300009357Microbial communities of water from the North Atlantic ocean - ACM13EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009728Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_213_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012688Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES030 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012702Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012705Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012718Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES050 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012727Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES016 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012732Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES039 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012742Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES027 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012748Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES045 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012751Freshwater microbial communities from Lake Montjoie, Canada - M_130821_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012753Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES038 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012754Freshwater microbial communities from Lake Montjoie, Canada - M_130821_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012756Freshwater microbial communities from Lake Croche, Canada - C_130709_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012758Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012760Freshwater microbial communities from Lake Croche, Canada - C_130709_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012761Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012763Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012769Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012771Freshwater microbial communities from Lake Croche, Canada - C_130625_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012772Freshwater microbial communities from Lake Simoncouche, Canada - S_130826_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012775Freshwater microbial communities from Lake Montjoie, Canada - M_140625_M_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012776Freshwater microbial communities from Lake Montjoie, Canada - M_130207_X_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012785Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES011 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013077Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES009 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016685Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES029 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016695Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016696Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES024 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016766Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041409AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018542Metatranscriptome of marine microbial communities from Baltic Sea - GS677_3p0EnvironmentalOpen in IMG/M
3300018553Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p8EnvironmentalOpen in IMG/M
3300018603Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782239-ERR1711906)EnvironmentalOpen in IMG/M
3300018610Metatranscriptome of marine microbial communities from Baltic Sea - LD35M_ls2EnvironmentalOpen in IMG/M
3300018619Metatranscriptome of marine microbial communities from Baltic Sea - GS855_ls4EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019085Metatranscriptome of marine microbial communities from Baltic Sea - GS670_3p0_dTEnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019207Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019261Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413BS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020160Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1EnvironmentalOpen in IMG/M
3300020162Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021284Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021299Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021336Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1073 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021847Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022369Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1119 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024480Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024483Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024533Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024549Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024560Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024567Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024849Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025570Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300026405Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026415Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027892Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300028108Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031571Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_535_32.3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034050Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07May2013-rr0095EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
B570J29032_10951774413300002408FreshwaterLYNLNMPQLDPFIVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0005252J37289_10354313300002674MarineFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF*
B570J40625_10029158753300002835FreshwaterMPQLDPFIVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0006246J48908_101604013300003303SeawaterFVVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF*
Ga0008457_101265213300003681SeawaterLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF*
Ga0005851_100933313300003684Freshwater And SedimentQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI*
Ga0005853_101307913300003754Freshwater And SedimentESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI
Ga0063232_1001333333300004054Freshwater LakeMPQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI*
Ga0007749_120481113300004762Freshwater LakeQLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0007754_101450613300004764Freshwater LakeMPQLDPFIVCENSVSLLLFFWIVLFLFVYILVPLVKLRFVIVSEKSSSQESAKISAPFYGNAFKFNDTFI*
Ga0007754_146694933300004764Freshwater LakeSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0007750_101798743300004767Freshwater LakePQLDPFIVCENSVSLLLFFWIVLFLFVYILVPLVKLRFVIVSEKSSSQESAKISAPFYGNAFKFNDTFI*
Ga0007750_102123233300004767Freshwater LakeFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI*
Ga0007762_167077413300004768Freshwater LakePFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI*
Ga0007744_124729113300004784Freshwater LakeLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI*
Ga0007753_149005013300004786Freshwater LakeYYMPQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI*
Ga0007752_1122381113300004789Freshwater LakeESSVSLLLFFWIVLFLFVYILVPLVKLRFVIVSEKSSSQESAKISAPFYGNAFKFNDTFI
Ga0007761_1015725523300004792Freshwater LakeLISLYNLNMPQLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0007751_1012748213300004794Freshwater LakeMPQLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0007764_1006250013300004797Freshwater LakePQLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0007759_1012686153300004836Freshwater LakeDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0068881_103288933300005418Freshwater LakeFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI*
Ga0068879_173639913300005420Freshwater LakePQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI*
Ga0068885_194775233300005565Freshwater LakeSSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0075512_131856813300006374AqueousVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKSEETCTPFYGSAFKFNDTFF*
Ga0075494_136223713300006382AqueousVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSLDKAEKTSLPFYGKISKFNETLYSA*
Ga0075516_143307733300006384AqueousFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKLEETCTPFYGSAFKFNDTFF*
Ga0075517_100159733300006393AqueousVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKSEETCTPFYGSAFKFNDTFF*
Ga0075517_100333113300006393AqueousVSLLLFFWILTFLFVYILVPLVKLRFVIVSKKNTSDQIEKTCKPFYGNTFKFNDTFI*
Ga0075493_100766393300006396AqueousMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF*
Ga0031676_139864513300006728Deep OceanLDPYIICQSSVSLLLFFWICIFLFIYILTPLIKLRFVLIDEKDVLQNFKEDSLPFYGKTSKFNDILS*
Ga0031676_140836433300006728Deep OceanPFVVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF*
Ga0075467_10000617273300006803AqueousMPQLDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSLDKAEKTSLPFYGKISKFNETLYSA*
Ga0114351_106889693300008117Freshwater, PlanktonMPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI*
Ga0103696_102645233300008791Ocean WaterESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0103480_10236413300008915Bay WaterESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSHELEKTCTPFYGNTFKFNDTIV
Ga0103486_100811513300008921Bay WaterRPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSHELEKTCTPFYGNTFKFNDTIV*
Ga0103487_100633533300008922Bay WaterPPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSHELEKTCTPFYGNTFKFNDTIV*
Ga0114973_1006004713300009068Freshwater LakeMPQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPF
Ga0114971_1076200423300009185Freshwater LakeCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI*
Ga0114972_10011870163300009187Freshwater LakeMPQLDPFVVCESSVSLLLFFWVLIFLFVFVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI*
Ga0103827_100854433300009357River WaterESSVSLLVFFWISIFLFVYILVPLIKLRFVIVKDKSSLHQSNEECKPFYGKTSNFNDTFC
Ga0115008_1026163413300009436MarineMPQLDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKTSLPFYGKISKFNETLYSA*
Ga0115007_1035824723300009441MarineMPQLDPFVVCESSVSILLFFWTLIFLFVYILVPLIKLRFVIVSEKNALHQVENTCTPFYGNTFKFNDTFF*
Ga0115568_1015633353300009498Pelagic MarineMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVCEKNALHQVEETCKPFYGNTFKFNDTFF*
Ga0115099_1098792243300009543MarineLDPFVVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF*
Ga0115101_101256583300009592MarineMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFLTFIF*
Ga0115103_137184013300009599MarineQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF*
Ga0115100_1000528413300009608MarineQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFFLTFIF*
Ga0115100_1080302123300009608MarineFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKVSLPFYGKISKFNETLYSA*
Ga0115104_1012137523300009677MarineMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSHELEKICTPFYGNTFKFNDTIV*
Ga0115104_1029927213300009677MarineLDPFVVCESSVSLLVFFWISIFLFVYILVPLIKLRFAIVNDKSSLQQSNNICKPFYGKTSNFNDTFC*
Ga0123371_16186413300009728MarineQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKSEETCTPFYGSAFKFNDTFF*
Ga0123373_14143823300009732MarineLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKSEETCTPFYGSAFKFNDTFF*
Ga0123377_104063813300009735MarinePQLDLFVVCESSISLLFFFWISIFLFVYILVPLIKLRFVIVSEKNSSHELLKKDLLPSYGSVNKFNDTFF*
Ga0129323_109501713300010404AqueousFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFFLTFIF*
Ga0133913_1054203883300010885Freshwater LakeMPQLDPFVVLESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISIPFYGNAFKFNDTFI*
Ga0138264_151318713300012414Polar MarinePMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNTLHQVEETCTPFYGNTFKFNDTFF*
Ga0138259_181593333300012416Polar MarinePFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNTLHQVEETCTPFYGNTFKFNDTFF*
Ga0138260_1014249513300012419Polar MarineFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNTLHQVEETCTPFYGNTFKFNDTFF*
Ga0129328_101708753300012472AqueousFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSLDKAEKTSLPFYGKISKFNETLYSA*
Ga0129347_100868833300012504AqueousVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKSEETCTPFYGSAFKFNDTFF*
Ga0129325_106513133300012516AqueousPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF*
Ga0129350_127879333300012523AqueousFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKSEETCTPFYGSAFKFNDTFF*
Ga0129350_139944613300012523AqueousQLDPFVVCESSVSLLLFFWILTFLFVYILVPLVKLRFVIVSKKNTSDQIEKTCKPFYGNTFKFNDTFI*
Ga0129331_126236053300012524AqueousSNPSIPTFMPQLDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKTSLPFYGKISKFNETLYSA*
Ga0129353_161217233300012525AqueousLDPFVVCESSVSLLLFFWILTFLFVYILVPLVKLRFVIVSKKNTSDQIEKTCKTFYGNTFKFNDTFI*
Ga0157541_113257833300012688FreshwaterLDPFVVFESSFSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0157596_115364113300012702FreshwaterLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI*
Ga0157555_118558813300012705FreshwaterFVVFESSFSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHELGKISVPFYGNAFKFNDTFI*
Ga0157557_107325313300012718FreshwaterESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI
Ga0157531_129619613300012727FreshwaterQLDPFVVFESSFSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0157549_118378613300012732FreshwaterLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0157539_10673313300012742FreshwaterFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHELGKISVPFYGNAFKFNDTFI*
Ga0157553_102068833300012748FreshwaterFESSFSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138277_105905313300012751Freshwater LakeQLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHELGKISVPFYGNAFKFNDTFI*
Ga0157548_103490333300012753FreshwaterMPQLDPFVVFESSFSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138278_111201013300012754Freshwater LakeMPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGEISLPFYGNTFKFNDTFI*
Ga0138278_114019333300012754Freshwater LakeCYYMPQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI*
Ga0138272_111377013300012756Freshwater LakeQLDPFVVLESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138285_112390733300012758Freshwater LakeLDPFVVLESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138273_104415913300012760Freshwater LakeESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGEISLPFYGNTFKFNDTFI
Ga0138273_105279133300012760Freshwater LakePQLDPFVVLESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138288_115867943300012761Freshwater LakePQLDPFIVCENSVSLLLFFWVVLFLFVYILVPLVKLRFVIVSEKSSSQESAKISAPFYGNAFKFNDTFI*
Ga0138289_117300233300012763Freshwater LakeMPQLDPFIVCENSVSLLLFFWVVLFLFVYILVPLVKLRFVIVSEKSSSQESAKISAPFYGNAFKFNDTFI*
Ga0138289_119907113300012763Freshwater LakePFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138279_102565113300012769Freshwater LakePFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI*
Ga0138279_124812633300012769Freshwater LakeSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHELGKISVPFYGNAFKFNDTFI*
Ga0138270_111263933300012771Freshwater LakeYNLNMPQLDPFVVLESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138287_102127733300012772Freshwater LakeLDPFIVCENSVSLLLFFWVVLFLFVYILVPLVKLRFVIVSEKSSSQESAKISAPFYGNAFKFNDTFI*
Ga0138280_101734233300012775Freshwater LakeLDPFIVCENSVSLLLFFWIVLFLFVYILVPLVKLRFVIVSEKSSSQESAKISAPFYGNAFKFNDTFI*
Ga0138280_105615213300012775Freshwater LakeGFKSPYTFYNLNMPQLDPFVVLESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138275_126567023300012776Freshwater LakeMPQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESGEISLPFYGNTFKFNDTFI*
Ga0157528_11766223300012785FreshwaterLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0138257_169025033300012935Polar MarineQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNTLHQVEETCTPFYGNTFKFNDTFF*
Ga0129340_118762133300012963AqueousQQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKSEETCTPFYGSAFKFNDTFF*
Ga0129341_115711213300012966AqueousPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKSEETCTPFYGSAFKFNDTFF*
Ga0129332_131626933300012969AqueousLDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKTSLPFYGKISKFNETLYSA*
Ga0164294_1106069113300013006FreshwaterMPQLDPFVVFESSFSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHELGKISVPFYGNAFKFNDTFI*
Ga0157526_114621133300013077FreshwaterLDPFVVFESSVSLLLFFWILILLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI*
Ga0180050_109507913300016685FreshwaterFVVFESSFSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHELGKISVPFYGNAFKFNDTFI
Ga0180059_101757813300016695FreshwaterPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPLYGNAFKFNDTFI
Ga0180049_101031433300016696FreshwaterDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI
Ga0182096_114615713300016740Salt MarshDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKLEETCTPFYGSAFKFNDTFF
Ga0182091_119366513300016766Salt MarshFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKLEETCTPFYGSAFKFNDTFFLTFILIMK
Ga0188841_10051613300018542Freshwater LakeQLDPFVVCESSVSLLLVFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0188840_10110233300018553Freshwater LakeMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0192881_100381743300018603MarineMGFMPQLDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKTSLPFYGKISKFNETLYSA
Ga0192881_100788643300018603MarineHGMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0188884_100609233300018610Freshwater LakeVMPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0188877_101171933300018619Freshwater LakeYKFYYYMPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0192983_102252413300018684MarineHGMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNTLHQVEETCTPFYGNTFKFNDTFF
Ga0192950_101323343300018791MarineTGMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0192961_1003043943300018980MarineVHGMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0192947_1025381223300018982MarineLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKTSLPFYGKISKFNETLYSA
Ga0192945_1002339013300019036MarineYQRRVHGMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0192945_1009716913300019036MarineIPTFMPQLDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKTSLPFYGKISKFNETLYSA
Ga0193336_1011864433300019045MarineHGLLVFFWISIFLFVYILVPLIKLRFVIVKDKSSLHQSNEECKPFYGKTSNFNDTFC
Ga0188830_101451413300019085Freshwater LakeFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0192980_102023513300019123MarineHGMPQLDPFVVCESSISLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNTLHQVEETCTPFYGNTFKFNDTFF
Ga0180032_114089833300019201EstuarinePFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI
Ga0180034_112331613300019207EstuarineLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGEISLPFYGNTFKFNDTFI
Ga0180037_102046213300019214EstuarineLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0182097_134767633300019261Salt MarshLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNSSQKLEETCTPFYGSAFKFNDTFF
Ga0211733_1119698233300020160FreshwaterMPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSLPFYGNTFKFNDTFI
Ga0211735_1043046063300020162FreshwaterMPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0206687_168223713300021169SeawaterPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0210299_14655833300021284EstuarineCYYMPQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI
Ga0210302_108373113300021299EstuarinePQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI
Ga0210308_100325213300021303EstuarineFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0210296_108761813300021305EstuarineQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0210296_108988623300021305EstuarineDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKVSLPFYGNISKFNETLYSA
Ga0210301_131482013300021325EstuarineFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGEISLPFYGNTFKFNDTFI
Ga0206696_163041213300021334SeawaterDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0210307_140427033300021336EstuarineVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0206692_130314413300021350SeawaterPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0206693_140934833300021353SeawaterPQLDPFVVCESSASLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEEICTPFYGKTFKFNDTFF
Ga0210305_109479313300021847EstuarineMPQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI
Ga0210305_114256613300021847EstuarineVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGEISLPFYGNTFKFNDTFI
Ga0210304_106973213300021849EstuarineQLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI
Ga0210310_100700343300022369EstuarineLITVAMRVRIPLCPYNLNMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0228683_101782613300023694SeawaterFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYVNTFKFNDTFF
Ga0255223_106098513300024480FreshwaterQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0255224_107004713300024483FreshwaterLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0256299_108573633300024533FreshwaterVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0256308_107864533300024549FreshwaterLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI
Ga0256306_111488633300024560FreshwaterVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI
Ga0256307_111201533300024567FreshwaterESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0255230_105574933300024849FreshwaterDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0208660_100016253300025570AqueousMPQLDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSLDKAEKTSLPFYGKISKFNETLYSA
Ga0209534_1039797913300025880Pelagic MarineMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTF
Ga0256296_103421933300026405FreshwaterPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0256298_105486223300026415FreshwaterLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGETSVPFYGNAFKFNDTFI
Ga0247593_107368913300026449SeawaterLNLNMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0247578_110211613300026458SeawaterESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF
Ga0247588_110697713300026465SeawaterVVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF
Ga0247571_110564133300026495SeawaterLDPFVVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF
Ga0209092_1022292913300027833MarineMPQLDPFVVCESSVSLLLFFWISIFLFVYILVPLVKLRFVIVSEKNSSDKAEKTSLPFYGKISKFNETLYSA
Ga0209550_1009936363300027892Freshwater LakeMPQLDPFVVFESSVSLLLFFWILIFLFVYILVPLVKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI
Ga0256305_112526023300028108FreshwaterESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKSSSHESGKISVPFYGNAFKFNDTFI
Ga0247584_100273453300028110SeawaterLDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFFLTFIF
Ga0256412_111709343300028137SeawaterMPQLDPFVVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF
Ga0256413_120957313300028282SeawaterFVVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF
Ga0256413_122142523300028282SeawaterMPRSDPFVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0247572_113307833300028290SeawaterPFVVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF
Ga0210315_102601533300028329EstuarineYMPQLDPFVVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI
Ga0247597_104286433300028334SeawaterVCESSVSLLLFFWILTFLFVYILVPLIKLRFVIVSEKNTLDQVEETCTPFYGKTFKFNDTFF
Ga0307398_1073909323300030699MarineFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNTLHQVEETCTPFYGNTFKFNDTFF
Ga0308133_102299033300030721MarineVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNALHQVENTCTPFYGNTFKFNDTFF
Ga0308141_105429433300031571MarineMRVRIPLCPYNLNMPQLDPVVVCESSVSLLLFFWTLIFLFVYILVPLVKLRFVIVSEKNALHQVEETCKPFYGNTFKFNDTFF
Ga0307984_116230023300031658MarineMPQLDPFVVCESSVSLLLFFWTLIFLFVYILVPLIKLRFVIVSEKNTLHQVEETCTPFYGNTFKFNDTFF
Ga0334977_0000533_9076_92883300033978FreshwaterMPQLDPFIVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTFI
Ga0334998_0060836_2394_26003300034019FreshwaterMPQLDPFIVCESSVSLLLFFWVLIFLFVYVLVPLIKLRFVIVSEKNSSHESEETSVPFYGNAFKFNDTF
Ga0335023_0000182_24130_243423300034050FreshwaterMPQLDPFVVCESSVSLLLFFWILIFLFVYILVPLIKLRFVIVSEKNSSHESGEISLPFYGNTFKFNDTFI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.