| Basic Information | |
|---|---|
| Family ID | F030405 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 185 |
| Average Sequence Length | 39 residues |
| Representative Sequence | RGAMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 185 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.62 % |
| % of genes near scaffold ends (potentially truncated) | 98.38 % |
| % of genes from short scaffolds (< 2000 bps) | 87.03 % |
| Associated GOLD sequencing projects | 57 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (82.162 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (75.135 % of family members) |
| Environment Ontology (ENVO) | Unclassified (85.405 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (78.919 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 28.79% β-sheet: 0.00% Coil/Unstructured: 71.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 185 Family Scaffolds |
|---|---|---|
| PF05016 | ParE_toxin | 4.32 |
| PF00578 | AhpC-TSA | 2.16 |
| PF03544 | TonB_C | 2.16 |
| PF08308 | PEGA | 1.62 |
| PF04326 | AlbA_2 | 1.08 |
| PF07927 | HicA_toxin | 1.08 |
| PF06940 | DUF1287 | 1.08 |
| PF13905 | Thioredoxin_8 | 1.08 |
| PF02493 | MORN | 1.08 |
| PF14300 | DUF4375 | 1.08 |
| PF11731 | Cdd1 | 1.08 |
| PF13470 | PIN_3 | 1.08 |
| PF07676 | PD40 | 0.54 |
| PF13495 | Phage_int_SAM_4 | 0.54 |
| PF03852 | Vsr | 0.54 |
| PF00480 | ROK | 0.54 |
| PF00079 | Serpin | 0.54 |
| PF13508 | Acetyltransf_7 | 0.54 |
| PF13683 | rve_3 | 0.54 |
| PF15580 | Imm53 | 0.54 |
| PF01934 | HepT-like | 0.54 |
| PF02687 | FtsX | 0.54 |
| PF12950 | TaqI_C | 0.54 |
| PF14289 | DUF4369 | 0.54 |
| PF13676 | TIR_2 | 0.54 |
| PF11185 | DUF2971 | 0.54 |
| PF04402 | SIMPL | 0.54 |
| PF01789 | PsbP | 0.54 |
| PF12675 | DUF3795 | 0.54 |
| PF14254 | DUF4348 | 0.54 |
| PF06769 | YoeB_toxin | 0.54 |
| PF03190 | Thioredox_DsbH | 0.54 |
| PF13975 | gag-asp_proteas | 0.54 |
| PF01694 | Rhomboid | 0.54 |
| PF13588 | HSDR_N_2 | 0.54 |
| PF14338 | Mrr_N | 0.54 |
| PF05168 | HEPN | 0.54 |
| PF06054 | CoiA | 0.54 |
| PF03781 | FGE-sulfatase | 0.54 |
| PF00903 | Glyoxalase | 0.54 |
| PF08906 | DUF1851 | 0.54 |
| PF13432 | TPR_16 | 0.54 |
| PF14294 | DUF4372 | 0.54 |
| PF10077 | DUF2314 | 0.54 |
| COG ID | Name | Functional Category | % Frequency in 185 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 2.16 |
| COG1724 | Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family | General function prediction only [R] | 1.08 |
| COG4642 | Uncharacterized conserved protein | Function unknown [S] | 1.08 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.08 |
| COG3738 | Uncharacterized conserved protein YijF, DUF1287 family | Function unknown [S] | 1.08 |
| COG2849 | Antitoxin component YwqK of the YwqJK toxin-antitoxin module | Defense mechanisms [V] | 1.08 |
| COG2865 | Predicted transcriptional regulator, contains HTH domain | Transcription [K] | 1.08 |
| COG5620 | Uncharacterized conserved protein, DUF1851 domain | Function unknown [S] | 0.54 |
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
| COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
| COG4469 | Competence protein CoiA, contains predicted nuclease domain | General function prediction only [R] | 0.54 |
| COG4115 | Toxin component of the Txe-Axe toxin-antitoxin module, Txe/YoeB family | Defense mechanisms [V] | 0.54 |
| COG3727 | G:T-mismatch repair DNA endonuclease Vsr, very short patch repair protein | Replication, recombination and repair [L] | 0.54 |
| COG3471 | Predicted secreted (periplasmic) protein | Function unknown [S] | 0.54 |
| COG2968 | Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain | Function unknown [S] | 0.54 |
| COG2859 | Outer membrane channel-forming protein BP26/OMP28, SIMPL family | Cell wall/membrane/envelope biogenesis [M] | 0.54 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.54 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.54 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.54 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.54 |
| COG1331 | Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains | General function prediction only [R] | 0.54 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.54 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.24 % |
| Unclassified | root | N/A | 16.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004154|Ga0066603_10193557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 917 | Open in IMG/M |
| 3300004282|Ga0066599_100565592 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300006651|Ga0101725_112888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii | 870 | Open in IMG/M |
| 3300006896|Ga0102513_103516 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 2474 | Open in IMG/M |
| 3300007909|Ga0111548_1020538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1283 | Open in IMG/M |
| 3300008948|Ga0116018_1044217 | Not Available | 510 | Open in IMG/M |
| 3300008987|Ga0116022_1000011 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 204401 | Open in IMG/M |
| 3300009075|Ga0105090_10390112 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 849 | Open in IMG/M |
| 3300009081|Ga0105098_10502115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 618 | Open in IMG/M |
| 3300009085|Ga0105103_10500446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 682 | Open in IMG/M |
| 3300009165|Ga0105102_10530815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 642 | Open in IMG/M |
| 3300009669|Ga0116148_1242033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 762 | Open in IMG/M |
| 3300009669|Ga0116148_1343554 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 601 | Open in IMG/M |
| 3300009671|Ga0123334_1165785 | Not Available | 1043 | Open in IMG/M |
| 3300009671|Ga0123334_1227353 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300009671|Ga0123334_1273913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 741 | Open in IMG/M |
| 3300009675|Ga0116149_1070006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1948 | Open in IMG/M |
| 3300009675|Ga0116149_1127302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1266 | Open in IMG/M |
| 3300009675|Ga0116149_1214169 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 874 | Open in IMG/M |
| 3300009680|Ga0123335_1397967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 636 | Open in IMG/M |
| 3300009687|Ga0116144_10161126 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1223 | Open in IMG/M |
| 3300009689|Ga0116186_1447304 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300009692|Ga0116171_10065478 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → unclassified Marinilabiliaceae → Marinilabiliaceae bacterium JC017 | 2290 | Open in IMG/M |
| 3300009692|Ga0116171_10160289 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1300 | Open in IMG/M |
| 3300009692|Ga0116171_10263590 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia elliptica | 950 | Open in IMG/M |
| 3300009692|Ga0116171_10269395 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 937 | Open in IMG/M |
| 3300009692|Ga0116171_10364356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 776 | Open in IMG/M |
| 3300009692|Ga0116171_10396685 | Not Available | 735 | Open in IMG/M |
| 3300009692|Ga0116171_10431878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 696 | Open in IMG/M |
| 3300009692|Ga0116171_10441012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 688 | Open in IMG/M |
| 3300009693|Ga0116141_10263267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 924 | Open in IMG/M |
| 3300009693|Ga0116141_10332060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 795 | Open in IMG/M |
| 3300009694|Ga0116170_10391580 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Mariniphaga → Mariniphaga sediminis | 763 | Open in IMG/M |
| 3300009696|Ga0116177_10325254 | Not Available | 818 | Open in IMG/M |
| 3300009696|Ga0116177_10385019 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 740 | Open in IMG/M |
| 3300009713|Ga0116163_1144215 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 873 | Open in IMG/M |
| 3300009713|Ga0116163_1204799 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 691 | Open in IMG/M |
| 3300009771|Ga0116155_10075952 | Not Available | 1543 | Open in IMG/M |
| 3300009771|Ga0116155_10156037 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 980 | Open in IMG/M |
| 3300009771|Ga0116155_10233883 | Not Available | 762 | Open in IMG/M |
| 3300009771|Ga0116155_10265280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Leptolinea → unclassified Leptolinea → Leptolinea sp. | 706 | Open in IMG/M |
| 3300009771|Ga0116155_10279927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 683 | Open in IMG/M |
| 3300009771|Ga0116155_10294049 | Not Available | 663 | Open in IMG/M |
| 3300009771|Ga0116155_10306965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 646 | Open in IMG/M |
| 3300009772|Ga0116162_10173758 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 936 | Open in IMG/M |
| 3300009772|Ga0116162_10340318 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 614 | Open in IMG/M |
| 3300009775|Ga0116164_10182237 | Not Available | 944 | Open in IMG/M |
| 3300009775|Ga0116164_10257491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 753 | Open in IMG/M |
| 3300009775|Ga0116164_10268635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 733 | Open in IMG/M |
| 3300009776|Ga0116154_10041814 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300009776|Ga0116154_10050097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Mangrovibacterium → Mangrovibacterium diazotrophicum | 1973 | Open in IMG/M |
| 3300009776|Ga0116154_10076024 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Imperialibacter | 1543 | Open in IMG/M |
| 3300009776|Ga0116154_10205804 | Not Available | 859 | Open in IMG/M |
| 3300009776|Ga0116154_10254625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 759 | Open in IMG/M |
| 3300009776|Ga0116154_10259097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium HGW-Bacteroidetes-21 | 751 | Open in IMG/M |
| 3300009776|Ga0116154_10440613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 555 | Open in IMG/M |
| 3300009778|Ga0116151_10194509 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flammeovirga → unclassified Flammeovirga → Flammeovirga sp. EKP202 | 1023 | Open in IMG/M |
| 3300009778|Ga0116151_10322044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 723 | Open in IMG/M |
| 3300009779|Ga0116152_10321943 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 743 | Open in IMG/M |
| 3300009779|Ga0116152_10341420 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Algoriphagus | 714 | Open in IMG/M |
| 3300009780|Ga0116156_10285834 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 839 | Open in IMG/M |
| 3300009781|Ga0116178_10288826 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Ornithobacterium → Ornithobacterium rhinotracheale | 816 | Open in IMG/M |
| 3300009781|Ga0116178_10340200 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium | 739 | Open in IMG/M |
| 3300009781|Ga0116178_10545648 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 562 | Open in IMG/M |
| 3300009782|Ga0116157_10145593 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Luteibaculaceae → Luteibaculum → Luteibaculum oceani | 1353 | Open in IMG/M |
| 3300009783|Ga0116158_10163655 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. 4G9 | 1337 | Open in IMG/M |
| 3300009783|Ga0116158_10204818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1152 | Open in IMG/M |
| 3300009838|Ga0116153_10067378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1530 | Open in IMG/M |
| 3300009838|Ga0116153_10160509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 931 | Open in IMG/M |
| 3300009838|Ga0116153_10267285 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009838|Ga0116153_10358517 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 596 | Open in IMG/M |
| 3300009868|Ga0130016_10152425 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1848 | Open in IMG/M |
| 3300010346|Ga0116239_10045662 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 4240 | Open in IMG/M |
| 3300010346|Ga0116239_10103578 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300010349|Ga0116240_10104604 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2222 | Open in IMG/M |
| 3300010349|Ga0116240_10669368 | Not Available | 676 | Open in IMG/M |
| 3300010350|Ga0116244_10026185 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 5311 | Open in IMG/M |
| 3300010350|Ga0116244_10316774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1058 | Open in IMG/M |
| 3300010351|Ga0116248_10469282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 930 | Open in IMG/M |
| 3300010352|Ga0116247_10138564 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2080 | Open in IMG/M |
| 3300010352|Ga0116247_10188625 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1720 | Open in IMG/M |
| 3300010352|Ga0116247_10200499 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1656 | Open in IMG/M |
| 3300010352|Ga0116247_10363603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1141 | Open in IMG/M |
| 3300010352|Ga0116247_10385640 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1100 | Open in IMG/M |
| 3300010352|Ga0116247_10563359 | Not Available | 870 | Open in IMG/M |
| 3300010352|Ga0116247_10571794 | Not Available | 862 | Open in IMG/M |
| 3300010352|Ga0116247_10908210 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium | 647 | Open in IMG/M |
| 3300010352|Ga0116247_11364983 | Not Available | 503 | Open in IMG/M |
| 3300010353|Ga0116236_10123964 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2461 | Open in IMG/M |
| 3300010353|Ga0116236_10164320 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Marinilabilia → Marinilabilia salmonicolor | 2051 | Open in IMG/M |
| 3300010353|Ga0116236_10303534 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1393 | Open in IMG/M |
| 3300010353|Ga0116236_10803961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 754 | Open in IMG/M |
| 3300010355|Ga0116242_10498790 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1114 | Open in IMG/M |
| 3300010356|Ga0116237_10384793 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → unclassified Marinilabiliaceae → Marinilabiliaceae bacterium JC017 | 1251 | Open in IMG/M |
| 3300010356|Ga0116237_10546348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1009 | Open in IMG/M |
| 3300010356|Ga0116237_11500341 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300010357|Ga0116249_10084612 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3023 | Open in IMG/M |
| 3300010357|Ga0116249_10254498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1627 | Open in IMG/M |
| 3300010357|Ga0116249_10597393 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1012 | Open in IMG/M |
| 3300010357|Ga0116249_10645818 | Not Available | 969 | Open in IMG/M |
| 3300010357|Ga0116249_10726669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 907 | Open in IMG/M |
| 3300010357|Ga0116249_10886030 | Not Available | 810 | Open in IMG/M |
| 3300010357|Ga0116249_11009466 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 752 | Open in IMG/M |
| 3300010357|Ga0116249_11285304 | Not Available | 655 | Open in IMG/M |
| 3300010357|Ga0116249_11387662 | Not Available | 627 | Open in IMG/M |
| 3300010357|Ga0116249_11976708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 511 | Open in IMG/M |
| 3300010429|Ga0116241_10145124 | All Organisms → cellular organisms → Bacteria | 2005 | Open in IMG/M |
| 3300010429|Ga0116241_10465121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 993 | Open in IMG/M |
| 3300010429|Ga0116241_10489898 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon M8B2D | 963 | Open in IMG/M |
| 3300010429|Ga0116241_10528476 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 921 | Open in IMG/M |
| 3300010429|Ga0116241_10656827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 811 | Open in IMG/M |
| 3300010429|Ga0116241_10708541 | All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Caldiserica → Caldisericia → Caldisericales → unclassified Caldisericales → Caldisericales bacterium | 775 | Open in IMG/M |
| 3300010429|Ga0116241_10713261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 772 | Open in IMG/M |
| 3300010429|Ga0116241_10845796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 700 | Open in IMG/M |
| 3300010429|Ga0116241_10880723 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Mangrovibacterium → Mangrovibacterium diazotrophicum | 683 | Open in IMG/M |
| 3300010429|Ga0116241_11454605 | Not Available | 512 | Open in IMG/M |
| (restricted) 3300013127|Ga0172365_10601295 | Not Available | 629 | Open in IMG/M |
| 3300014255|Ga0075320_1085340 | Not Available | 608 | Open in IMG/M |
| 3300014258|Ga0075315_1079052 | Not Available | 595 | Open in IMG/M |
| 3300019231|Ga0179935_1303285 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 683 | Open in IMG/M |
| 3300020814|Ga0214088_1141859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 938 | Open in IMG/M |
| 3300020814|Ga0214088_1444544 | Not Available | 922 | Open in IMG/M |
| 3300021603|Ga0226659_10256368 | All Organisms → cellular organisms → Bacteria → FCB group → Fibrobacteres → Fibrobacteria → Fibrobacterales → Fibrobacteraceae → Fibrobacter → unclassified Fibrobacter → Fibrobacter sp. | 797 | Open in IMG/M |
| 3300021603|Ga0226659_10263064 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia dokdonensis | 784 | Open in IMG/M |
| 3300021603|Ga0226659_10354834 | Not Available | 648 | Open in IMG/M |
| 3300025563|Ga0210112_1096262 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum | 609 | Open in IMG/M |
| 3300025611|Ga0209408_1014072 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2928 | Open in IMG/M |
| 3300025611|Ga0209408_1021338 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2181 | Open in IMG/M |
| 3300025611|Ga0209408_1081853 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 875 | Open in IMG/M |
| 3300025611|Ga0209408_1100161 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 764 | Open in IMG/M |
| 3300025702|Ga0209203_1111745 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300025702|Ga0209203_1148864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 735 | Open in IMG/M |
| 3300025702|Ga0209203_1242813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 521 | Open in IMG/M |
| 3300025706|Ga0209507_1085610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 898 | Open in IMG/M |
| 3300025708|Ga0209201_1020748 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia | 3390 | Open in IMG/M |
| 3300025715|Ga0209310_1130448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 749 | Open in IMG/M |
| 3300025715|Ga0209310_1173759 | Not Available | 622 | Open in IMG/M |
| 3300025847|Ga0209607_1029801 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3000 | Open in IMG/M |
| 3300025855|Ga0209717_1036680 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2533 | Open in IMG/M |
| 3300025856|Ga0209604_1137535 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae | 1038 | Open in IMG/M |
| 3300025856|Ga0209604_1216177 | Not Available | 753 | Open in IMG/M |
| 3300025856|Ga0209604_1238481 | Not Available | 701 | Open in IMG/M |
| 3300025858|Ga0209099_1048259 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2105 | Open in IMG/M |
| 3300025858|Ga0209099_1147424 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium | 958 | Open in IMG/M |
| 3300025858|Ga0209099_1236862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae → Sunxiuqinia → Sunxiuqinia dokdonensis | 685 | Open in IMG/M |
| 3300025859|Ga0209096_1192527 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 776 | Open in IMG/M |
| 3300025861|Ga0209605_1010371 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5967 | Open in IMG/M |
| 3300025867|Ga0209098_1096800 | Not Available | 1363 | Open in IMG/M |
| 3300025867|Ga0209098_1153208 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
| 3300025867|Ga0209098_1275119 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Prolixibacteraceae | 657 | Open in IMG/M |
| 3300025871|Ga0209311_1130691 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1070 | Open in IMG/M |
| 3300025871|Ga0209311_1238050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Flexilinea → Flexilinea flocculi | 709 | Open in IMG/M |
| 3300025877|Ga0208460_10175704 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 840 | Open in IMG/M |
| 3300025902|Ga0209202_1028509 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin008 | 2271 | Open in IMG/M |
| 3300025902|Ga0209202_1031171 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2137 | Open in IMG/M |
| 3300025902|Ga0209202_1070008 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1211 | Open in IMG/M |
| 3300025902|Ga0209202_1104972 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 903 | Open in IMG/M |
| 3300025902|Ga0209202_1120531 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 816 | Open in IMG/M |
| 3300025902|Ga0209202_1147277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 705 | Open in IMG/M |
| 3300025902|Ga0209202_1186917 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300026290|Ga0209510_1062596 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1503 | Open in IMG/M |
| 3300026290|Ga0209510_1097923 | Not Available | 1063 | Open in IMG/M |
| 3300026311|Ga0209723_1319379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 511 | Open in IMG/M |
| 3300027719|Ga0209467_1205058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 686 | Open in IMG/M |
| 3300027719|Ga0209467_1257539 | Not Available | 591 | Open in IMG/M |
| 3300027721|Ga0209492_1208178 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300027739|Ga0209575_10075052 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → unclassified Thermoplasmata → Thermoplasmata archaeon M8B2D | 1235 | Open in IMG/M |
| 3300027739|Ga0209575_10168055 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 786 | Open in IMG/M |
| 3300027796|Ga0209373_10286838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 674 | Open in IMG/M |
| 3300027800|Ga0209800_10076253 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1545 | Open in IMG/M |
| 3300027800|Ga0209800_10333819 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 632 | Open in IMG/M |
| 3300027972|Ga0209079_10259434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 591 | Open in IMG/M |
| 3300027975|Ga0209391_10182452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 880 | Open in IMG/M |
| 3300028849|Ga0307352_105243 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300028850|Ga0307358_101474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2699 | Open in IMG/M |
| 3300028850|Ga0307358_110539 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales | 1013 | Open in IMG/M |
| 3300029797|Ga0243129_1014727 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3172 | Open in IMG/M |
| 3300029797|Ga0243129_1056138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 1343 | Open in IMG/M |
| 3300029797|Ga0243129_1143617 | Not Available | 650 | Open in IMG/M |
| 3300029799|Ga0311022_10507187 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1192 | Open in IMG/M |
| 3300029834|Ga0307324_102143 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1754 | Open in IMG/M |
| 3300029942|Ga0168096_1025066 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Dysgonomonadaceae → Dysgonomonas | 1424 | Open in IMG/M |
| 3300033434|Ga0316613_10301883 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300033434|Ga0316613_11220644 | Not Available | 518 | Open in IMG/M |
| 3300033757|Ga0373404_0239183 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → unclassified Veillonellaceae → Veillonellaceae bacterium | 545 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 75.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 4.86% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.78% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 3.78% |
| Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 2.70% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Unclassified → Sediment | 1.62% |
| Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment | 1.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.08% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.08% |
| Oil Sands | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands | 1.08% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.54% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.54% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.54% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.54% |
| Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 0.54% |
| Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 0.54% |
| Anaerobic Digester Leachate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Leachate | 0.54% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300006651 | T8 (1) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
| 3300006896 | Final time point T34 (3) (BES) benzoate enrichments of Methanogenic microbial communities using Athabasca oil sands as inoculum | Environmental | Open in IMG/M |
| 3300007909 | Microbial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_686d_2 | Environmental | Open in IMG/M |
| 3300008948 | Combined Assembly of De NOVO T10 (BES) Tyne Sediment Benzoate Gp0125656, Gp0125657, Gp0125121 | Environmental | Open in IMG/M |
| 3300008987 | Combined Assembly of De NOVO T34 (live) FTP Oil sands Benzoate Gp0125668, Gp0125720, Gp0125669 | Environmental | Open in IMG/M |
| 3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009689 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG | Engineered | Open in IMG/M |
| 3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009694 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG | Engineered | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300009713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG | Engineered | Open in IMG/M |
| 3300009771 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG | Engineered | Open in IMG/M |
| 3300009772 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC105_MetaG | Engineered | Open in IMG/M |
| 3300009775 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG | Engineered | Open in IMG/M |
| 3300009776 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG | Engineered | Open in IMG/M |
| 3300009778 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG | Engineered | Open in IMG/M |
| 3300009779 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC119_MetaG | Engineered | Open in IMG/M |
| 3300009780 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300009782 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG | Engineered | Open in IMG/M |
| 3300009783 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC052_MetaG | Engineered | Open in IMG/M |
| 3300009838 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG | Engineered | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300010346 | AD_USMOca | Engineered | Open in IMG/M |
| 3300010349 | AD_HKTAca | Engineered | Open in IMG/M |
| 3300010350 | AD_HKSTca | Engineered | Open in IMG/M |
| 3300010351 | AD_USPNca | Engineered | Open in IMG/M |
| 3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300010429 | AD_USRAca | Engineered | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
| 3300014258 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleA_D1 | Environmental | Open in IMG/M |
| 3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
| 3300021603 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules spades | Engineered | Open in IMG/M |
| 3300025563 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025611 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC107_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025702 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC109_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC030_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025847 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Hong Kong - AD_UKC117_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025855 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025856 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025867 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025871 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025877 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025902 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC032_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026290 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027719 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027796 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5 (SPAdes) | Environmental | Open in IMG/M |
| 3300027800 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027975 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028849 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Thr1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300028850 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Leu1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029797 | Sediment microbial communities from Yellow Sea, Weihai, China - HGD.2 | Environmental | Open in IMG/M |
| 3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
| 3300029834 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Gly1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029942 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP8 - Uppsala-digested 109 | Engineered | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033757 | Leachate microbial community from anaerobic digester in University of Toronto, Ontario, Canada - S62W2 SP | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066603_101935571 | 3300004154 | Freshwater | VGVFLHRGAMQGYDVVLFILALAKTVTPAGAGAAAPPTT* |
| Ga0066599_1005655922 | 3300004282 | Freshwater | MKGYEVVLFILALAKTPDKSGQAVTPQGSLRREPGLAAPPAT* |
| Ga0101725_1128881 | 3300006651 | Sediment | FCTRGAMQGYDGYFFILALAKTVTPGGSPRREPGRPAPRW* |
| Ga0102513_1035163 | 3300006896 | Oil Sands | ACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT* |
| Ga0111548_10205383 | 3300007909 | Sediment | DAMQGYDVVLFILALAKTVTPGGSPRREPGRAVPLTT* |
| Ga0116018_10442171 | 3300008948 | Sediment | LQDYDVDLFILALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116022_1000011170 | 3300008987 | Oil Sands | MHRGGGACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT* |
| Ga0105090_103901122 | 3300009075 | Freshwater Sediment | GCFCTRGAMQGYDCYYFILALAKTVTPAGGPWREPGRAVAPATELPL* |
| Ga0105098_105021152 | 3300009081 | Freshwater Sediment | PQLRGGARFCTRGAKQDYDVVLNIVALAKTVTPAGGPRREPGQAAPLTT* |
| Ga0105103_105004462 | 3300009085 | Freshwater Sediment | CTRGAIQGYDVVLSIVALAKTVTPGGSPRREPGQAAPLTT* |
| Ga0105102_105308152 | 3300009165 | Freshwater Sediment | GAMQGYDVVLFILALAKTVTPAGSPRREPGQAAPPAT* |
| Ga0116148_12420331 | 3300009669 | Anaerobic Digestor Sludge | MQGYDVDLFILALAKTVTPGGSPRREPGRAVAPATKPSL* |
| Ga0116148_13435543 | 3300009669 | Anaerobic Digestor Sludge | FCTRGAMQDYDVVLLILALAKTVTPPGGPRREPGQAAPPTT* |
| Ga0123334_11657854 | 3300009671 | Anaerobic Biogas Reactor | FCTRGAMQGYDGYYLILALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0123334_12273531 | 3300009671 | Anaerobic Biogas Reactor | MQDYDVVLFVLALAKTVTPGGGPRREPGQAVALATKPLH* |
| Ga0123334_12739132 | 3300009671 | Anaerobic Biogas Reactor | GAMQDYDVYLFVLALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116149_10700063 | 3300009675 | Anaerobic Digestor Sludge | VQGYDVVLFILALAKTVTPGGGPRREPGQAAPLTT* |
| Ga0116149_11273023 | 3300009675 | Anaerobic Digestor Sludge | FCTRGAMQGYDVDLFILALAKTVTPGGGPRREPGRAVPLTT* |
| Ga0116149_12141691 | 3300009675 | Anaerobic Digestor Sludge | RGGARFCTRGAMKGYDGYYFVLALAKTVTPGGSPRREPGQAVAQATKPPI* |
| Ga0123335_13979671 | 3300009680 | Anaerobic Biogas Reactor | MQDYDGYLFILALAKTVTPGGGPRREPGRPAPPLKV |
| Ga0116144_101611262 | 3300009687 | Anaerobic Digestor Sludge | CFCTRGAMQDYDVYLFVLALAKTVTPEGGPRREPGQPVPPTTEQSN* |
| Ga0116186_14473041 | 3300009689 | Anaerobic Digestor Sludge | QGYDVVLFILALAKTVTAAGGPRREPGRAVAPATKPPL* |
| Ga0116171_100654783 | 3300009692 | Anaerobic Digestor Sludge | RGAMQGYDGYYFILALAKTVTPGGSPRREPGQAAPLTT* |
| Ga0116171_101602892 | 3300009692 | Anaerobic Digestor Sludge | ARFCTRGAMQGYDVDLFIVALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116171_102635901 | 3300009692 | Anaerobic Digestor Sludge | GAMQGYDGYYFILALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0116171_102693953 | 3300009692 | Anaerobic Digestor Sludge | RGAMQDYDIVLIIVTLAKTVTPGGSPRREPGQAVPPTT* |
| Ga0116171_103643562 | 3300009692 | Anaerobic Digestor Sludge | GAMQGYDVVLYIIALAKTVTPGGSPRREPGQAVPPTT* |
| Ga0116171_103966852 | 3300009692 | Anaerobic Digestor Sludge | CTRGAMQSYDVDLFIVALAKTVTPPGSPRREPGRAAPPTT* |
| Ga0116171_104318782 | 3300009692 | Anaerobic Digestor Sludge | MQDYDVDLFIIALAKTVTPGGGPRRQPGQAVPPAT* |
| Ga0116171_104410122 | 3300009692 | Anaerobic Digestor Sludge | RGAMWDYDFVLFILALAKTVTPEGSPRREPGRAAPPTT* |
| Ga0116141_102632672 | 3300009693 | Anaerobic Digestor Sludge | GAMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116141_103320602 | 3300009693 | Anaerobic Digestor Sludge | RDAMQGYDVVLFVLALAKTVTPGGSPRREPGQAAPLTT* |
| Ga0116170_103915801 | 3300009694 | Anaerobic Digestor Sludge | RGAMQGYDVVLFIVALAKTVTPGGSAPRERGRAAPLTT* |
| Ga0116177_103252542 | 3300009696 | Anaerobic Digestor Sludge | YDVVLFIVALAKTVTPAGGPRREPGQAVAPATKPPL* |
| Ga0116177_103850191 | 3300009696 | Anaerobic Digestor Sludge | GYDGYYFILALAKTVTPGGGPRRKPGRAVAPATKPPL* |
| Ga0116163_11442151 | 3300009713 | Anaerobic Digestor Sludge | GAMQGYDVVLFILALAKTVTPGGSAPRERGRAAPPTT* |
| Ga0116163_12047991 | 3300009713 | Anaerobic Digestor Sludge | LSIVALAKTVTPRGSPRREPGQAAPLTTNRSSLA* |
| Ga0116155_100759522 | 3300009771 | Anaerobic Digestor Sludge | GACFCTRGAMQDYDGYYFILALAKTVTPGGSPRREPGQAAPLTT* |
| Ga0116155_101560372 | 3300009771 | Anaerobic Digestor Sludge | QGYDDVLFILALAKTVTPRGSPRREPGQAAPPTT* |
| Ga0116155_102338832 | 3300009771 | Anaerobic Digestor Sludge | CTRGAMQGYDVDLFILALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116155_102652801 | 3300009771 | Anaerobic Digestor Sludge | MQGYDVVLFIVALVRTETPGGSPPRKPGWAVALATKHSSLV |
| Ga0116155_102799273 | 3300009771 | Anaerobic Digestor Sludge | CTRGAEQGYDGYYFILALAKTVTPGGSAPRERGRAAPPTT* |
| Ga0116155_102940491 | 3300009771 | Anaerobic Digestor Sludge | GAMPGYEVDLFILALAKTVTPPGGHRREPGQAVPQTT* |
| Ga0116155_103069651 | 3300009771 | Anaerobic Digestor Sludge | FCTRGAMRDYDVVLFIVALAKTVTPGGSPRREPGQAAPLAT* |
| Ga0116162_101737583 | 3300009772 | Anaerobic Digestor Sludge | CTRGAMQGYDVVLFILALAKTVTPGGGPRRKPGQAAPQTT* |
| Ga0116162_103403182 | 3300009772 | Anaerobic Digestor Sludge | GAMQGYDVVLFILALAKTVTPGGSPRRKPGRAAPLTTK* |
| Ga0116164_101822372 | 3300009775 | Anaerobic Digestor Sludge | MRDYDVYLFILALAKTVTPPGSPRREPGQAAPPIP* |
| Ga0116164_102574912 | 3300009775 | Anaerobic Digestor Sludge | AMQGYDVDLFVLALAKTVTPGGGPRREPGRAVAPATKPPL* |
| Ga0116164_102686351 | 3300009775 | Anaerobic Digestor Sludge | GARFCTRGAMQDYDVVLSILALAKTVTPGGSPRREPGRAAPPTT* |
| Ga0116154_100418143 | 3300009776 | Anaerobic Digestor Sludge | GAMQGYDVVLFILALAKTVTPPGSPRREPGRAVPPTT* |
| Ga0116154_100500973 | 3300009776 | Anaerobic Digestor Sludge | GAMQGYDVVLFIVALAKTVTPGGGPRREPGQAAPSTT* |
| Ga0116154_100760243 | 3300009776 | Anaerobic Digestor Sludge | GAMQGYDVILFILALAKTVTPLGGPRREPGQAVPPTT* |
| Ga0116154_102058041 | 3300009776 | Anaerobic Digestor Sludge | QGYYVVLFIVAVAKTVTPIGGPRREPGQAAPPTT* |
| Ga0116154_102546251 | 3300009776 | Anaerobic Digestor Sludge | TCFCTRGAIQGYDVVWFIVALAKTVTPGGGPRREPGRAAPPTT* |
| Ga0116154_102590972 | 3300009776 | Anaerobic Digestor Sludge | CTRGAMQDYDVVLFILALAKTVTPRGGPRREPGRAAPLTT* |
| Ga0116154_104406132 | 3300009776 | Anaerobic Digestor Sludge | YDVDLFILALAKTVTPGGSPRREPGQAAPLTTNGPL* |
| Ga0116151_101945092 | 3300009778 | Anaerobic Digestor Sludge | QDYDVVLFVLALAKTVTPGGGPRREPGQAAPHTT* |
| Ga0116151_103220441 | 3300009778 | Anaerobic Digestor Sludge | GAMQGYDVVLFILAMAKTVTPAGGPRREPGRAVALATKPPL* |
| Ga0116152_103219432 | 3300009779 | Anaerobic Digestor Sludge | MQGYDVVLSILALAKTVTPGGSPRREPGQAAPLAT* |
| Ga0116152_103414201 | 3300009779 | Anaerobic Digestor Sludge | RGAMQGYDVVLFILALAKTVTPGGSPRREPGRAAPPAT* |
| Ga0116156_102858342 | 3300009780 | Anaerobic Digestor Sludge | CTRGAMQDYDVYLFVLALAKTVTPEGGPRREPGQPVPPTTEQSN* |
| Ga0116178_102888262 | 3300009781 | Anaerobic Digestor Sludge | MQGYDVVLFIIALAKTVTPAGGPRREPGRAVAPATKPPL* |
| Ga0116178_103402001 | 3300009781 | Anaerobic Digestor Sludge | FCTRGAMQDYDVVLFIIALAKTVTPGGSPRREPGQAVPLTT* |
| Ga0116178_105456481 | 3300009781 | Anaerobic Digestor Sludge | QDYDVDLFILALAKTVTPGGSPRREPGRAAPPTT* |
| Ga0116157_101455933 | 3300009782 | Anaerobic Digestor Sludge | CTRGAMQDYDVVLSILALAKTVTPGGSPRREPGRAAPPTT* |
| Ga0116158_101636554 | 3300009783 | Anaerobic Digestor Sludge | TRGAMQVYDGYYLILALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116158_102048182 | 3300009783 | Anaerobic Digestor Sludge | QGYDVVLFILALAKTVTPGGGPRREPGRAAPPAT* |
| Ga0116153_100673783 | 3300009838 | Anaerobic Digestor Sludge | CTRGAVQDYDVVLYILALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0116153_101605091 | 3300009838 | Anaerobic Digestor Sludge | TRGAMQGYDVVLYILALAKTVTPGGGPRREPGQAVPPTT* |
| Ga0116153_102672851 | 3300009838 | Anaerobic Digestor Sludge | QGYDVVLFILAMAKTVTPGGSPRRQPGRAVAQATKPLL* |
| Ga0116153_103585171 | 3300009838 | Anaerobic Digestor Sludge | TRGAVWGYDVVLFILALAKTVTPAGGPRREPGQAAPPTT* |
| Ga0130016_101524254 | 3300009868 | Wastewater | CFCTRGAKQGYDIDLFILALAKTVTPGGSPRREPGQAVPPTT* |
| Ga0116239_100456621 | 3300010346 | Anaerobic Digestor Sludge | QDYDVVLFVLALAKTVTPEGGPRREPGRAVPPTT* |
| Ga0116239_101035784 | 3300010346 | Anaerobic Digestor Sludge | TRGAMQVYDVVLFVLALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0116240_101046043 | 3300010349 | Anaerobic Digestor Sludge | DYDGYLFILALAKTVTPGGGPRREPGRPVPLATLLTF* |
| Ga0116240_106693683 | 3300010349 | Anaerobic Digestor Sludge | RDAMQGYDVVLFIVALAKTVTPRGSPRREPGQAAPPTT* |
| Ga0116244_100261857 | 3300010350 | Anaerobic Digestor Sludge | FCTLGAMQGYDVVLIIVALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116244_103167741 | 3300010350 | Anaerobic Digestor Sludge | FCTRGAMQDYDVVLFILALAKTVTPGGGPRREPGQAAPLTT* |
| Ga0116248_104692822 | 3300010351 | Anaerobic Digestor Sludge | GYDVVLFILALAKTVTPGGSPRREPGQAVAPATKPSLY* |
| Ga0116247_101385641 | 3300010352 | Anaerobic Digestor Sludge | TRGAMQSYDVDLFILALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0116247_101886251 | 3300010352 | Anaerobic Digestor Sludge | CFCTRGAVQDYDVRLFILALAKTVTPRGSPRREPGQAAPPTT* |
| Ga0116247_102004993 | 3300010352 | Anaerobic Digestor Sludge | GAMQGYDVVLFILALAKTVTPGGSPRREPGQAAPPAT* |
| Ga0116247_103636033 | 3300010352 | Anaerobic Digestor Sludge | RGAMQDYDVVLFILALAKTVTPGGGPRREPGQVAPPTT* |
| Ga0116247_103856401 | 3300010352 | Anaerobic Digestor Sludge | CTRGAQQSYDVVLFILALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116247_105633591 | 3300010352 | Anaerobic Digestor Sludge | MQGYDVDLFVLALAKTVTPSGGPRREPGQAAPPTN* |
| Ga0116247_105717941 | 3300010352 | Anaerobic Digestor Sludge | FCTRGAMQVCDVVLFIVALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0116247_109082102 | 3300010352 | Anaerobic Digestor Sludge | TRGAMQGYDVVLFIVALAKTVTPRGGPRRQPGRPAPPL* |
| Ga0116247_113649832 | 3300010352 | Anaerobic Digestor Sludge | MQVYDVVLNIVALEKTVTPGGGPRREPGQAAPLTT* |
| Ga0116236_101239645 | 3300010353 | Anaerobic Digestor Sludge | CNRGAVQGYDVVLFIVALAKTVTPGGGPRREPGRAVPPTT* |
| Ga0116236_101643201 | 3300010353 | Anaerobic Digestor Sludge | MQGHDVVLFILALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116236_103035343 | 3300010353 | Anaerobic Digestor Sludge | FCTRGAMQGYDGYYFILALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0116236_108039611 | 3300010353 | Anaerobic Digestor Sludge | TRGAMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116242_104987901 | 3300010355 | Anaerobic Digestor Sludge | RGAMQDYDVYLFVLALAKTVTPEGGPRREPGQPVPPTTEQSN* |
| Ga0116237_103847933 | 3300010356 | Anaerobic Digestor Sludge | RGAMQDYDVDLFIVALAKTVTPRGSPRREPGQAAPLTT* |
| Ga0116237_105463481 | 3300010356 | Anaerobic Digestor Sludge | VQDYDVVLSVLALAKTVTPGEGPRREPGLAAPPTT* |
| Ga0116237_115003412 | 3300010356 | Anaerobic Digestor Sludge | MHGYDGYYFILALAKTVTPGGGPRREPGQAAPLTT* |
| Ga0116249_100846126 | 3300010357 | Anaerobic Digestor Sludge | TRGAIQGYDIVLSIVALAKTVTPGGSPRREPGQAVPPTT* |
| Ga0116249_102544983 | 3300010357 | Anaerobic Digestor Sludge | RGAVQGYDVVLFIVALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0116249_105973932 | 3300010357 | Anaerobic Digestor Sludge | RGAMQGYDGYYLILALAKTVTPGGGPRRQPGQAAPLTT* |
| Ga0116249_106458182 | 3300010357 | Anaerobic Digestor Sludge | TRGAMQGYDGYYLILALAKTVTPGGGPRREPGQAAPLTT* |
| Ga0116249_107266692 | 3300010357 | Anaerobic Digestor Sludge | RGAMQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116249_108860301 | 3300010357 | Anaerobic Digestor Sludge | CTRGAEQGYDVDLFVLALAKTVTPPGSPRRVPGQAAPSTT* |
| Ga0116249_110094662 | 3300010357 | Anaerobic Digestor Sludge | VALPQSRGGARFCTRGAMQGNDGYYLIVALAKTVTPGGGPRRE |
| Ga0116249_112853041 | 3300010357 | Anaerobic Digestor Sludge | RDAKQDYDVVLNIVALAKTVTPAGGPRREPGQAAPPAT* |
| Ga0116249_113876622 | 3300010357 | Anaerobic Digestor Sludge | AMQGYYVVLFIVAVAKTVTPIGGPRREPGQAAPPTT* |
| Ga0116249_119767082 | 3300010357 | Anaerobic Digestor Sludge | ACFCTRGAMRVYDVDLFILALAKTVTPGGSPRREPGQAAPLTTNGPL* |
| Ga0116241_101451241 | 3300010429 | Anaerobic Digestor Sludge | RGAMRVYDVDLFILALAKTVTPGGGPRREPGRAAPPTT* |
| Ga0116241_104651212 | 3300010429 | Anaerobic Digestor Sludge | CTRGAMQGYDVVLLILALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0116241_104898981 | 3300010429 | Anaerobic Digestor Sludge | TRGAVQGYDGYYFILALAKTVTPQGSPRREPGQAAPPTT* |
| Ga0116241_105284761 | 3300010429 | Anaerobic Digestor Sludge | TRGAMLGYDVVLFILALAKTVTPGGSAPRERGRAAPPTT* |
| Ga0116241_106568271 | 3300010429 | Anaerobic Digestor Sludge | HGAMHYYDVVLFIIALAKTVTPGGGPRREPGQAAPPTT* |
| Ga0116241_107085413 | 3300010429 | Anaerobic Digestor Sludge | CTRGAMQDYDVVLFILALAKTVTPGGDPRREPGQAAPPTT* |
| Ga0116241_107132612 | 3300010429 | Anaerobic Digestor Sludge | RFCTRGAMQVYDVALFIVALAKTVTPRGSPRREPGQAVPPTT* |
| Ga0116241_108457962 | 3300010429 | Anaerobic Digestor Sludge | AMQGYDIILFILALAKTVTPGGSPRREPGRPVPPTT* |
| Ga0116241_108807231 | 3300010429 | Anaerobic Digestor Sludge | QGYDVVLFILALAKTVTPIGSPRREPGQAAPPTT* |
| Ga0116241_114546051 | 3300010429 | Anaerobic Digestor Sludge | QGYDVDLIILALAKTVTPPGSAPRERGRAAPPTT* |
| (restricted) Ga0172365_106012952 | 3300013127 | Sediment | GGARFCTRGAMQGYDGYYFILALAKTVTPAGGPRREPGRAVAPATKPPL* |
| Ga0075320_10853401 | 3300014255 | Natural And Restored Wetlands | ACFCTRGAVQDYDGYLFILALAKTVTPGGSPRREPGQAAPPTT* |
| Ga0075315_10790522 | 3300014258 | Natural And Restored Wetlands | CFCTRGAVQGYDGYYLVLALAKTVTPRGSPRRQPGQAVAPATKLPL* |
| Ga0179935_13032851 | 3300019231 | Anaerobic Digestor Sludge | GARFCTRGAMKGYDGYYFVLALAKTVTPGGSPRREPGQAVAQATKPPI |
| Ga0214088_11418592 | 3300020814 | Granular Sludge | FCTRGAMQDYDVDLFIVALAKTVTPGGGPLRKQGQAAPPTT |
| Ga0214088_14445441 | 3300020814 | Granular Sludge | DAVLFILALAKTVTSGGSPRREPGQAAPPTTYLSS |
| Ga0226659_102563682 | 3300021603 | Granular Sludge | CTRGAMQGYDVVLFIVALAKTVTPGGSPRREPGRAAPPTT |
| Ga0226659_102630643 | 3300021603 | Granular Sludge | FCTRGAMQDYDVVLLILALAKTVTPPGGPRREPGQAAPPAT |
| Ga0226659_103548341 | 3300021603 | Granular Sludge | VPNEERSGCFCTRGAMQDCDVVLFIVALAKTVTPEGSPRREPGQAAPPTT |
| Ga0210112_10962622 | 3300025563 | Natural And Restored Wetlands | MQGYDVVLFILALAKTVTPGGGPRREPGQAAPLSTYG |
| Ga0209408_10140726 | 3300025611 | Anaerobic Digestor Sludge | MQGYDVVLFILALAKTVTPGGGPRREPGQAAPPTT |
| Ga0209408_10213381 | 3300025611 | Anaerobic Digestor Sludge | MQDYDVVLFIIALAKTVTPGGSPRREPGQAVAPTTEPSSSFTQ |
| Ga0209408_10818531 | 3300025611 | Anaerobic Digestor Sludge | MQGYDVVLFILALAKTVTPGGSAPRERGRAAPPTT |
| Ga0209408_11001611 | 3300025611 | Anaerobic Digestor Sludge | YDVVLSIVALAKTVTPRGSPRREPGQAAPLTTNRSSLA |
| Ga0209203_11117454 | 3300025702 | Anaerobic Digestor Sludge | MQGYDVVLFVLALAKTVTPAGGPRREPGRAVAPTTKPPL |
| Ga0209203_11488642 | 3300025702 | Anaerobic Digestor Sludge | GAMQGYDVDLFVLALAKTVTPGGGPRREPGRAVAPATKPPL |
| Ga0209203_12428131 | 3300025702 | Anaerobic Digestor Sludge | TRGAMRDYDVYLFILALAKTVTPPGSPRREPGQAAPPIP |
| Ga0209507_10856101 | 3300025706 | Anaerobic Digestor Sludge | CTRGAMQDYDFVLSILALAKTVTPGGSPRREPGQAAPPTT |
| Ga0209201_10207481 | 3300025708 | Anaerobic Digestor Sludge | MQGYDVDLFIFALAKTVTPRGGPRRKPGQAAPPTT |
| Ga0209310_11304481 | 3300025715 | Anaerobic Digestor Sludge | AKQGYGVVLFILALAKTVTPGGRPRREPGQAVPLTT |
| Ga0209310_11737592 | 3300025715 | Anaerobic Digestor Sludge | GAMQGYDGYYFILALAKTVKPGGSAPRERGRAAPLTT |
| Ga0209607_10298014 | 3300025847 | Anaerobic Digestor Sludge | TRGAMQGYDVVLFILALAKTVTPGGSPRREPGQAAPPTT |
| Ga0209717_10366803 | 3300025855 | Anaerobic Digestor Sludge | MQGYAVVLFVLALAKTVTPGGSAPRERGRAVPLAT |
| Ga0209604_11375353 | 3300025856 | Anaerobic Digestor Sludge | FALVVMQGYDGYYLILALAKTVTPGGGPRREPGRAVPPTTFSDLL |
| Ga0209604_12161772 | 3300025856 | Anaerobic Digestor Sludge | MQGYDVVLIILAMAKTVTPPGGPRREPGQAAPPNT |
| Ga0209604_12384812 | 3300025856 | Anaerobic Digestor Sludge | ACFCTRGAMQGYDGYYFILALAKTVTPGGSPRREPGQAAPPTT |
| Ga0209099_10482591 | 3300025858 | Anaerobic Digestor Sludge | AMQEYDVDLFILALAKTVTPGGGPRREPGQAAPPTT |
| Ga0209099_11474241 | 3300025858 | Anaerobic Digestor Sludge | RGAMQDYDIVLIIVTLAKTVTPGGSPRREPGQAVPPTT |
| Ga0209099_12368621 | 3300025858 | Anaerobic Digestor Sludge | CTRGAMQGYDVDLFILALAKTVTPPGGPRREPGQAAPPTT |
| Ga0209096_11925272 | 3300025859 | Anaerobic Digestor Sludge | MQDYDGVLNIVALAKTVTPRGSPRREPGLAAPPTT |
| Ga0209605_10103711 | 3300025861 | Anaerobic Digestor Sludge | ARFCTRGAIQGYDVVLYILALAKTVTPGGGPRREPGQAAPPTT |
| Ga0209098_10968003 | 3300025867 | Anaerobic Digestor Sludge | ALQDYDVVLFILALAKTVTPAGGPRREPGRAVPPAT |
| Ga0209098_11532082 | 3300025867 | Anaerobic Digestor Sludge | GAMQGYDVVLFILALAKTVTPGGSARREPGRAAPPTT |
| Ga0209098_12751191 | 3300025867 | Anaerobic Digestor Sludge | FCTRGAMPGYDVVLFVLALAKTVTPGGSPRREPGQAAPPTT |
| Ga0209311_11306911 | 3300025871 | Anaerobic Digestor Sludge | RGAMQDYDVYLFVLALAKTVTPEGGPRREPGQPVPPTTEQSN |
| Ga0209311_12380501 | 3300025871 | Anaerobic Digestor Sludge | YDVDLFILALAKTVTPAGGPRREPGRAVAPATKPPL |
| Ga0208460_101757042 | 3300025877 | Anaerobic Digestor Sludge | CFCTRGAVQSYNVVLFIVALAKTVTPRGSPRRQPGQAAPLTA |
| Ga0209202_10285091 | 3300025902 | Anaerobic Digestor Sludge | ACFCTRGAMQGHDGYYFILALAKTVTPGGSPRREPGRAVPLTT |
| Ga0209202_10311714 | 3300025902 | Anaerobic Digestor Sludge | YDVVLNIVALAKTVTPPRGPRREPGQAVAPVTKPPL |
| Ga0209202_10700081 | 3300025902 | Anaerobic Digestor Sludge | CTRGAMQGYDVDLFILALAKTVTPGGGPRREPGQAAPPTT |
| Ga0209202_11049721 | 3300025902 | Anaerobic Digestor Sludge | TRGAMLGYDVVLFILALAKTVTPGGSAPRERGRAAPPTT |
| Ga0209202_11205312 | 3300025902 | Anaerobic Digestor Sludge | LQGYDGYYFILALAKTVTPQGSPRREPGQAAPPTT |
| Ga0209202_11472773 | 3300025902 | Anaerobic Digestor Sludge | FCARGAMQGYDGYYFIFALAKTVTPGGSAPRERGRAAPPTT |
| Ga0209202_11869172 | 3300025902 | Anaerobic Digestor Sludge | VQDYDGYYLILALAKTVTPEGSPRREPGQAAPLTI |
| Ga0209510_10625962 | 3300026290 | Anaerobic Biogas Reactor | AMQGYVGYYFVLALAKTVTPAGGPRREPGQAAPLTT |
| Ga0209510_10979231 | 3300026290 | Anaerobic Biogas Reactor | GGARFCTRGAMQGYDGYYLILALAKTVTPGGSPRREPGQAAPPTT |
| Ga0209723_13193792 | 3300026311 | Anaerobic Biogas Reactor | FCTRGAMRGYDVDLFILALAKTVTPGGSPRREPGQAAPLTTNGPL |
| Ga0209467_12050581 | 3300027719 | Freshwater | FCTRGAMQGYDVALFILALAKTVTPGGGPRREPGQAAPLTT |
| Ga0209467_12575391 | 3300027719 | Freshwater | MQSYDGYYFILALAKTVTPGGGPRRKPGQAAPQTT |
| Ga0209492_12081781 | 3300027721 | Freshwater Sediment | MQGYNVDLFIVALAKTVTPRVGPRREPGQAAPLTTQQS |
| Ga0209575_100750521 | 3300027739 | Freshwater | CTRGAVQGYDGYYFILALAKTVTPQGSPRREPGQAAPPTT |
| Ga0209575_101680553 | 3300027739 | Freshwater | GAMQGYDVVLFILALAKTVTPGGGPRREPGRAVALATKPPL |
| Ga0209373_102868381 | 3300027796 | Freshwater | SGCFCTRGAMQGYDGYYFILALAKTPDESGQAVTPGGGPWREPGQAAPPTT |
| Ga0209800_100762534 | 3300027800 | Freshwater | TCGAMQDYDGYYLILALAKTVTPEGCPRREPGQAAPPTT |
| Ga0209800_103338191 | 3300027800 | Freshwater | GAMQGYDVVLFILALAKTVTPRGGPRREPGQAVAPATKPPF |
| Ga0209079_102594341 | 3300027972 | Freshwater Sediment | ACCCTRGAIQGYDVVLSIVALAKTVTPGGSPRREPGQAAPLTT |
| Ga0209391_101824521 | 3300027975 | Freshwater Sediment | GCFCTRGAMQGYDCYYFILALAKTVTPAGGPWREPGRAVAPATELPL |
| Ga0307352_1052433 | 3300028849 | Anaerobic Digestor Sludge | AMQGYDVVLFILALAKTVTPPGGPRREPGQAAPLTT |
| Ga0307358_1014741 | 3300028850 | Anaerobic Digestor Sludge | GYDVVLFILALAKTVTPPGDPRREPGRAAPPTTGLSS |
| Ga0307358_1105393 | 3300028850 | Anaerobic Digestor Sludge | RDALQDYDCYLFILALAKTVTPGGSPRREPGQAAPLAT |
| Ga0243129_10147275 | 3300029797 | Sediment | FCTRGAMQDYDVVLFILALAKTVTPGGGPRRESGQAAPLTT |
| Ga0243129_10561383 | 3300029797 | Sediment | TRGAMQDYDVVLFILALAKTVTPGGGPRREPGQVAPPTT |
| Ga0243129_11436171 | 3300029797 | Sediment | AMQVCDVVLYIVALAKTVTPGGGPRREPGQAAPPTT |
| Ga0311022_105071871 | 3300029799 | Anaerobic Digester Digestate | AMQGYDVVLFIVALAKTVTPGGSPRREPGQAAPPTT |
| Ga0307324_1021434 | 3300029834 | Anaerobic Digestor Sludge | PGCFCTRDALQDYGVVLSILALAKTVTPEGSPRQEPGQAAPPTT |
| Ga0168096_10250661 | 3300029942 | Biosolids | MQGYDVVLFIVALAKTVTPGGGPRREPGQAAPPTT |
| Ga0316613_103018831 | 3300033434 | Soil | GAMQGYDVVLFILALAKTVTPGGGPRREPGQAALPTT |
| Ga0316613_112206442 | 3300033434 | Soil | AMQGYDGYNFILALAKTVTPGGSPRREPWRAAPPTT |
| Ga0373404_0239183_266_373 | 3300033757 | Anaerobic Digester Leachate | MQGYDDDLFILALAKTVTPGGSPRREPGQAAPLTT |
| ⦗Top⦘ |