3300008948: Combined Assembly of De NOVO T10 (BES) Tyne Sediment Benzoate Gp0125656, Gp0125657, Gp0125121

Overview

Basic Information

• IMG/M Taxon OID: 3300008948
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117429 | Gp0125121 | Ga0116018
• Sample Name: Combined Assembly of De NOVO T10 (BES) Tyne Sediment Benzoate Gp0125656, Gp0125657, Gp0125121
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 220020862
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Sediment (non-saline)

Location Information

• Location: UK (Newcastle upon Tyne)
• Coordinates
  • Lat. (^o): 54.971158
  • Long. (^o): -1.703654
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030405	Metagenome / Metatranscriptome	185	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0116018_1044217	Not Available	510

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0116018_1044217	Ga0116018_10442171	F030405	LQDYDVDLFILALAKTVTPGGGPRREPGQAAPPTT*