3300008987: Combined Assembly of De NOVO T34 (live) FTP Oil sands Benzoate Gp0125668, Gp0125720, Gp0125669

Overview

Basic Information

• IMG/M Taxon OID: 3300008987
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0117890 | Gp0125668 | Ga0116022
• Sample Name: Combined Assembly of De NOVO T34 (live) FTP Oil sands Benzoate Gp0125668, Gp0125720, Gp0125669
• Sequencing Status: Permanent Draft
• Sequencing Center: Shell Corporation
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 142506679
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Alberta, Canada
• Coordinates
  • Lat. (^o): 57.02
  • Long. (^o): -111.65
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030405	Metagenome / Metatranscriptome	185	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0116022_1000011	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	204401

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0116022_1000011	Ga0116022_1000011170	F030405	MHRGGGACFCTRGAVQDYDGYYFILAMAKTVTPGGSPRREPGQAAPPTT*