| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300006651 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0117429 | Gp0125097 | Ga0101725 |
| Sample Name | T8 (1) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Shell Corporation |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 56267129 |
| Sequencing Scaffolds | 7 |
| Novel Protein Genes | 7 |
| Associated Families | 7 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Archaea | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | 2 |
| All Organisms → cellular organisms → Bacteria | 1 |
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | freshwater river biome → river → sediment |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Sediment (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | UK (Newcastle upon Tyne) | |||||||
| Coordinates | Lat. (o) | 54.971158 | Long. (o) | -1.703654 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030405 | Metagenome / Metatranscriptome | 185 | Y |
| F040697 | Metagenome / Metatranscriptome | 161 | Y |
| F047387 | Metagenome / Metatranscriptome | 150 | Y |
| F048390 | Metagenome / Metatranscriptome | 148 | Y |
| F091072 | Metagenome / Metatranscriptome | 108 | Y |
| F092111 | Metagenome / Metatranscriptome | 107 | Y |
| F102132 | Metagenome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0101725_112888 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Marinilabiliales → Marinilabiliaceae → Alkaliflexus → Alkaliflexus imshenetskii | 870 | Open in IMG/M |
| Ga0101725_113424 | Not Available | 848 | Open in IMG/M |
| Ga0101725_116763 | All Organisms → cellular organisms → Archaea | 738 | Open in IMG/M |
| Ga0101725_119853 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | 661 | Open in IMG/M |
| Ga0101725_124774 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp. | 574 | Open in IMG/M |
| Ga0101725_126065 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| Ga0101725_129263 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112 | 512 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0101725_112888 | Ga0101725_1128881 | F030405 | FCTRGAMQGYDGYFFILALAKTVTPGGSPRREPGRPAPRW* |
| Ga0101725_113424 | Ga0101725_1134242 | F048390 | MVRFVRTLQHRVTPKGRDFYALSIPPQVAEALNLKAGGAVSICVNPVKKGKFEITLKPASCDNINP* |
| Ga0101725_116763 | Ga0101725_1167632 | F047387 | MAAEISREVIILDEEYADAEYRRFLREEDKYMDFDEFCCQEGI* |
| Ga0101725_119853 | Ga0101725_1198532 | F040697 | VIAMKLIEKLVDDNVMDDILKEAADGYGDLIAAALVHKVSVKCLQTRVTQLRDLRAAWIS |
| Ga0101725_124774 | Ga0101725_1247741 | F092111 | VTPEEEGSDVREMVWEMSRTTNKILIFGIILILAILAVLMYCGI |
| Ga0101725_126065 | Ga0101725_1260652 | F102132 | MNTQTVVKNLESAINRICKDIKDKKGGSGADKLDSLAKLVNAYSRLIERDKEKEKDYDPMEDGDPNYYKKLEANNKDRRGIIR |
| Ga0101725_129263 | Ga0101725_1292632 | F091072 | MAGTMKETAMPVRGETDEEIKALLKGTDVAWTQYKRDHGTRVTS |
| ⦗Top⦘ |