 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F025295 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 202 |
| Average Sequence Length | 37 residues |
| Representative Sequence | IMVTGPGEATELLRRREVLIPEKLKFITRKSNLQKPI |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 202 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 4.46 % |
| % of genes near scaffold ends (potentially truncated) | 95.54 % |
| % of genes from short scaffolds (< 2000 bps) | 99.01 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.535 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (21.287 % of family members) |
| Environment Ontology (ENVO) | Unclassified (43.564 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.515 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.62% β-sheet: 0.00% Coil/Unstructured: 55.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 202 Family Scaffolds |
|---|---|---|
| PF13291 | ACT_4 | 0.99 |
| PF02254 | TrkA_N | 0.50 |
| PF00085 | Thioredoxin | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.53 % |
| All Organisms | root | All Organisms | 3.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 21.29% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 18.32% |
| Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 7.92% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 6.93% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 5.94% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 5.94% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 4.95% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.47% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 3.47% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.48% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 2.48% |
| Wastewater Sludge | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge | 1.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.99% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.99% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 0.99% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.99% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.50% |
| Sinkhole Freshwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater | 0.50% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.50% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.50% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.50% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.50% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000230 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- GS10_10 | Environmental | Open in IMG/M |
| 3300000235 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_3 | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001448 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk Metatranscriptome | Environmental | Open in IMG/M |
| 3300001801 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300001808 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300001810 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300002027 | Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k | Environmental | Open in IMG/M |
| 3300006355 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006364 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006372 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006646 | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_A3_L (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007219 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007232 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007233 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007244 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007253 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome) | Engineered | Open in IMG/M |
| 3300007327 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007526 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaT_CSR_2012 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009196 | Microbial communities of wastewater sludge from Singapore - Sludge1_b2_February | Environmental | Open in IMG/M |
| 3300009199 | Microbial communities of wastewater sludge from Singapore - Sludge7_b2_February | Environmental | Open in IMG/M |
| 3300009206 | Microbial communities of wastewater sludge from Singapore - Sludge11_b2_February | Environmental | Open in IMG/M |
| 3300009579 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009582 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009583 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009584 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009586 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009755 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010144 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010307 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011282 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2012 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
| 3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012777 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013046 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013078 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013080 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300019200 | Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019205 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC045_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019207 | Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019209 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW3_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019210 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC030_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019216 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC032_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019226 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC055_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019231 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019234 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019246 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020065 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020066 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT45_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021257 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.272 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021258 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.445 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021269 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.499 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021270 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.593 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021276 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.491 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021292 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.493 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021293 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.589 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021294 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.264 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021303 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021304 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.300 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021309 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.266 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021847 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021849 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021853 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.189 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022171 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022363 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.767 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022368 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.454 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022385 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S771 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025742 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025763 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
| 3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
| 3300028078 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028080 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028178 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_36m | Environmental | Open in IMG/M |
| 3300028261 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028329 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028621 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028623 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028647 | Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029674 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_50m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029685 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_40m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029687 | Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_6_6_36m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300034080 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.1 | Engineered | Open in IMG/M |
| 3300034652 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_02R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034653 | Metatranscriptome of peat soil microbial communities from wetland fen in Alaska, United States - Frozen_pond_03R_16 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_GS10_10DRAFT_101763062 | 3300000230 | Groundwater | MGAKSCNFNSPDEIMVTGAGKATELLRRRKVLIPEKLKFFTRKSNL |
| TB_PC08_3DRAFT_10796892 | 3300000235 | Groundwater | MGAKSCNFNSPDEIMVTGAGKATELLRRRKVLIPEKLKFFTRKSNLQKLI* |
| JGIcombinedJ13530_1057239022 | 3300001213 | Wetland | MVTGPGEAAELLRRREERNPEELKLITRKSNLLKPI* |
| JGI20219J14954_10038012 | 3300001448 | Wetland | DHGNWPGKATELLRRREVPIPEKLKFVTRKSNLQKPI* |
| JGI20219J14954_10045621 | 3300001448 | Wetland | DEIMVTGPGAAAELLRRREVPNPEKLKISFRKRR* |
| JGI20219J14954_10087572 | 3300001448 | Wetland | IMVTGPGKATELLRRREVLDPEKLKFVTRKSNLRKRI* |
| JGI20219J14954_10104702 | 3300001448 | Wetland | IMVTGPGDVAELLRRREVQIPKKLKFVTCKSNLLKPI* |
| JGI20219J14954_10120451 | 3300001448 | Wetland | IMVTGPGKAAELLRRREVPDPEKLKFITRKSDLQKPI* |
| JGI20217J20340_102481 | 3300001801 | Wetland | IMVTGPGEAAELLRRREVLIPEKLKFITRKSNLQKLI* |
| JGI20218J20341_10049411 | 3300001808 | Wetland | IMVTGPGEATELLKRREVLIPEKLKFFTRKSNLLKPI* |
| JGI20221J20338_10060611 | 3300001810 | Wetland | IMVTGPGEAAELLRRREERNPEELKLITRKSNLLKPI* |
| MIS_100646653 | 3300002027 | Sinkhole Freshwater | MVTGPGDAAELLRRREVLIPEKLKFITRKSNLQKPI* |
| Ga0075501_13795281 | 3300006355 | Aqueous | MVTGPGEAAELLRRREVPNPEKLKFITRKSNLLKPI* |
| Ga0075482_11623151 | 3300006364 | Aqueous | MVTGPGEAAELLRRREALIPEKLKFITRKSNLQKPI* |
| Ga0075489_10536621 | 3300006372 | Aqueous | DHGNWPGKATELLRRREVLIPEKLKFTTRKRNLQKPI* |
| Ga0099770_10606551 | 3300006646 | Activated Sludge | IMVTGPGDATELLRRREVLIPEKLKFLTRKSNLQKPI* |
| Ga0075025_10291241 | 3300007219 | Watersheds | VTGPGEATELLRRREVLNPEKFRFITRKSNLLKPI* |
| Ga0075183_100563611 | 3300007232 | Wastewater Effluent | MVTGPGEAAELLRRRKVLIPKKLKFITRKSNSQKPI* |
| Ga0075183_114026382 | 3300007232 | Wastewater Effluent | VSGLGKATELLKRRDVLIPEKLKFIIRKSNLQKPI* |
| Ga0075178_10478711 | 3300007233 | Wastewater Effluent | VTGPGDATELLRRRTVLIPEKLKFITRKSNLQKPN* |
| Ga0075167_100423391 | 3300007244 | Wastewater Effluent | MVTGLGEATELLKRRKVLIPEKLKFITRKRNLQKPI* |
| Ga0075182_112283661 | 3300007253 | Wastewater Effluent | HVSGLGKATELLKRRDVLIPEKLKFIIRKSNLQKPI* |
| Ga0075016_10423071 | 3300007327 | Watersheds | IMVTGPGDAAELLKRREVLIPEKLKFITRKSNLQMPI* |
| Ga0075016_10589081 | 3300007327 | Watersheds | IMVTGPGEAAELLKRREALIPEKLKFITRKSNLWKPI* |
| Ga0075022_10751401 | 3300007526 | Watersheds | MVTSPGKATELLRRREVLIPEKLKLIIRKSNLQKPI* |
| Ga0103745_100222311 | 3300009196 | Wastewater Sludge | IMVSGPGADTELLRRREVPTPDKQKLITRKGNLP* |
| Ga0103748_100298581 | 3300009199 | Wastewater Sludge | ITFERSDEIMVSGPGADTELLRRREVPTPDKQKLITRKGNLP* |
| Ga0103750_10146911 | 3300009206 | Wastewater Sludge | EIMVSGPGADTELLRRREVPTPDKQKLITRKGNLP* |
| Ga0115599_10057141 | 3300009579 | Wetland | IMVTGPGDAAELLRRREVLIPKKLKLITCKSNLQKPI* |
| Ga0115599_10169171 | 3300009579 | Wetland | IMVTGPGEAAELLKRREVLIPKKLKYLTRKSDLQKLN* |
| Ga0115599_10169761 | 3300009579 | Wetland | EIMVTGPGEAAELLRRREVLIPEKLKFITRKRNLQKPI* |
| Ga0115599_10486761 | 3300009579 | Wetland | IMVTGPGEAAELLRRREVLIPEKLKLITRKSDLQKPI* |
| Ga0115599_10923561 | 3300009579 | Wetland | IMVTGPGEAAELLRRREVLTPKKKKFFPRKRKLL* |
| Ga0115599_10979411 | 3300009579 | Wetland | IMVTGPGKDTELLKRRKVLIPKKLKFLTRKSDLQKPI* |
| Ga0115596_10358181 | 3300009580 | Wetland | IMVTGPGEAAELLRRRKVPIPKRLKFITRKSNSQKPI* |
| Ga0115596_10524671 | 3300009580 | Wetland | IMVTGPGEATELLKRRKVLIPEKLKFITRKSNLQKPI* |
| Ga0115596_11383711 | 3300009580 | Wetland | VTGPGEAAELLRRREVLNPEKLKFTTRKRNFQKLI* |
| Ga0115600_10393601 | 3300009581 | Wetland | EIMVTGPGEAAELLRRREVLIPEKLKFITRKSNLQMPI* |
| Ga0115600_10615512 | 3300009581 | Wetland | DYGNWPGEATELLKRRNVLIPEKLKFITRKSNLQKPI* |
| Ga0115600_10832241 | 3300009581 | Wetland | IMVTGPGDVAELLRRRKALIPEKLKFITRKSNLQKPI* |
| Ga0115600_11318971 | 3300009581 | Wetland | IMVTGLGKDAELLRRREVLNPEKLKFRTRKSNLQKLI* |
| Ga0115600_11881522 | 3300009581 | Wetland | IMVTGPGEATELLRRREVLIPEKLKFFTRKSNLLKPI* |
| Ga0115601_10254321 | 3300009582 | Wetland | IMVTGPGEAAELLRRREVLIPKKQKFFTRKRKLLK* |
| Ga0115601_10597631 | 3300009582 | Wetland | VTGLGKDAELLRRREVLNPEKLKFRTRKSNLQKLI* |
| Ga0115601_10997181 | 3300009582 | Wetland | IMVTGPGEAAELLRRREVLNPEKLKFTTRKRNFQKLI* |
| Ga0115601_11157291 | 3300009582 | Wetland | IMVTGPGDVAELLRRREVLIPEKLKFITRKSNLQKLI* |
| Ga0115598_10722201 | 3300009583 | Wetland | EIMVTGPGDAAELLRRREVLIPKKLKLITCKSNLQKPI* |
| Ga0115598_11931781 | 3300009583 | Wetland | IMVTGPGKDTELLKRRKVLIPKKLKFLTRKSNLQKPI* |
| Ga0115597_10982091 | 3300009584 | Wetland | IMVTGPGDAAELLRRRIALIPEKLKFITRKGNLQKPI* |
| Ga0115591_10532651 | 3300009586 | Wetland | DHGNWPGEAAELLKRREVLIPEKLKFITRKSNLWKPI* |
| Ga0115591_11137101 | 3300009586 | Wetland | EIMVTGPGDAAELLRRREVLIPEKLKFITRKSNLQKPI* |
| Ga0115602_10331971 | 3300009587 | Wetland | IMVTGPGEATELLRRREVLIPERLKFITRKSNSQKLI* |
| Ga0115602_11369261 | 3300009587 | Wetland | IMVTGPGEAAELLRRRKVLIPEKLKFITRKSNLQKLI* |
| Ga0115592_10158501 | 3300009755 | Wetland | IMVTGPGEATELLRRREVPNPEKLKFITRKSNLLKPI* |
| Ga0115592_10617111 | 3300009755 | Wetland | DHGNWPGKATELLRRREVLIPEKLKFKTRKSNLQKPI* |
| Ga0115592_11399161 | 3300009755 | Wetland | IMVTGPGEAAELLRRRKVLIPEKLKFITRKSNSQKPI* |
| Ga0115594_10103381 | 3300010131 | Wetland | DYGNWPGEATEFLKRRNVLIPEKLKFITRKSNLQKPI* |
| Ga0115595_11239311 | 3300010138 | Wetland | IMVTGLGEAAELLRRREVLNPEKLKFTTRKRNFQKLI* |
| Ga0115593_13560801 | 3300010144 | Wetland | DHGNWPGKATELLRRREVLIPEKLKFITRKRSLQKPI* |
| Ga0129319_10932031 | 3300010307 | Aqueous | GNWPGKATELLRRREVLIPEKLKFITRKRSLQKPI* |
| Ga0129319_11526412 | 3300010307 | Aqueous | GNWPGKATELLRRREVPIPEKLKFVTRKSNLWKPI* |
| Ga0138293_1076021 | 3300011282 | Watersheds | LFATSLPDEIMVTGPGEATELLRRREVLNPEKFRFITRKSNLLKPI* |
| Ga0151652_101158071 | 3300011340 | Wetland | IKVTGPGEATELLRRREVLIPEKLKFITRKSNLQKPI* |
| Ga0151652_104947981 | 3300011340 | Wetland | EIMVTGPGDAAELLRRREVLIPEKLKFITRKSNLRKPI* |
| Ga0151652_105491541 | 3300011340 | Wetland | IMVTGPGDAAELLRRREVLIPVMLKFLTRKSNLLKPI* |
| Ga0151652_120143161 | 3300011340 | Wetland | IMVTGPGDAAELLRRREVLIPEKLKLITRKSDLQKPI* |
| Ga0151652_120229432 | 3300011340 | Wetland | IMVTGPGEVTKLLRRREVLIPKKLKFFARKRKLQ* |
| Ga0151652_123000332 | 3300011340 | Wetland | MVTGPGKAAELLRRREVPDPEKLKFITRKSDLQKPI* |
| Ga0151652_126558071 | 3300011340 | Wetland | IMVSGPGEVTELLRRRKVLIPEKLKFLTRKSNLQKLI* |
| Ga0151652_126629661 | 3300011340 | Wetland | DHGNWPGKATELLRRREVLIPEKLKFFTRKRNLQKPI* |
| Ga0153880_10351681 | 3300012411 | Freshwater Sediment | EIMVTGPGEAAELLRRRKALIPKKLKFITRKSNLQMPI* |
| Ga0153880_11731591 | 3300012411 | Freshwater Sediment | FGDHGNRPGEAIKLLRRREVLNPEKQKKMARKSNFPMLI* |
| Ga0157627_12054462 | 3300012706 | Freshwater | GNWPGKATELLRRREVLIPEKLKFITRKRNLPKPI* |
| Ga0157607_12002501 | 3300012711 | Freshwater | DHGNWPGKATELLRRREVLIPEKLKFITRKRNLPKPI* |
| Ga0157605_12535311 | 3300012716 | Freshwater | HGNWPGKATELLRRREVLIPEKLKFITRKRNLPKPI* |
| Ga0157612_11475111 | 3300012721 | Freshwater | HGNWPGKATELLRRREVLDPEKLKFVTRKRNLPKPI* |
| Ga0157610_10784842 | 3300012725 | Freshwater | NWPGKATELLRRSEVLIPEKLKFTTRKRNLLKPI* |
| Ga0157625_12440352 | 3300012729 | Freshwater | NWPGEVAELLKRREVLIPEKLKFITRKSNLWKPN* |
| Ga0157624_10979042 | 3300012764 | Freshwater | VTGPGDATELLRRREVLIPEKLKFLTRKSNLQKPI* |
| Ga0138292_10041411 | 3300012777 | Freshwater Lake | DHGNWPGEATELLRRREVLIPEKLKFITRKRNLQKPI* |
| Ga0138292_10048101 | 3300012777 | Freshwater Lake | IMVTGPGEAAELLRRREVLNPEKFRFITRKSNLLKQI* |
| Ga0079038_1025722 | 3300013046 | Freshwater Wetlands | ETGPGEAAELLRRSGAHIPETLKKITRKVNFWIRN* |
| Ga0079038_1242851 | 3300013046 | Freshwater Wetlands | HGNWPGKATELLRRRKVLIPEKLKFITRKRSLQKPI* |
| Ga0079038_1258381 | 3300013046 | Freshwater Wetlands | VTGPGEATELLRRREVLIPEKLKFVTRKSNLQKPI* |
| Ga0079038_1266661 | 3300013046 | Freshwater Wetlands | MVTGPGEAAELLKRREVLIPKKLKYLTRKSDLQKLN* |
| Ga0079038_1450271 | 3300013046 | Freshwater Wetlands | VTGPGEATKFLRRSKVLIPEKLKFLTRKSNLQMLI* |
| Ga0153914_10966502 | 3300013078 | Freshwater Wetlands | VTGPGEAAELLRRSGAHIPETLKKITRKVNFWIRN* |
| Ga0153914_12579181 | 3300013078 | Freshwater Wetlands | GNWPGKATELLRRREVLIPEKLKFTTRKRNLQKPI* |
| Ga0153913_12839341 | 3300013080 | Freshwater Wetlands | DHGNWPGKATELLRRREVPIPEKLKFVTRKSNLWKPI* |
| Ga0153913_12855451 | 3300013080 | Freshwater Wetlands | IMVTGPGEAAELLRRSGAHIPETLKKITRKVNFWIRN* |
| Ga0170791_106427701 | 3300013295 | Freshwater | IMVTGPGEAAELLRRREVLNPEKFRFITRKSNLLKPI* |
| Ga0170791_125641702 | 3300013295 | Freshwater | IMVTGPGEATELLRRREVLIPEKLKFITRKSNLLKPI* |
| Ga0180036_10892261 | 3300019200 | Estuarine | MVTGPGAAAELLRRREVLIPKKLKFLTRKSNLQKPN |
| Ga0180032_10325691 | 3300019201 | Estuarine | RPPDEIMVTGLGEAAELLRRSGAHIPETLKKITRKVNFWIRN |
| Ga0180032_10719562 | 3300019201 | Estuarine | VTGPGEAAELLRRREVPNPEKLKFITRKSNLLKPI |
| Ga0179940_12199791 | 3300019205 | Anaerobic Digestor Sludge | VTGPGDAAELLRRRDVLIPEKLKFITRKSNLQKPI |
| Ga0180034_11798281 | 3300019207 | Estuarine | IMVTGPGEATELLRRREVPNPEKLKFITRKSNLLKPI |
| Ga0179951_12035771 | 3300019209 | Anaerobic Digestor Sludge | VTGSGADTELLRRREVPTPEKQKLITRKGNLPEPISKPVRLKE |
| Ga0179938_11616531 | 3300019210 | Anaerobic Digestor Sludge | VTGPGDAAELLRRREVLIPEKLKFITRKSNLQKPI |
| Ga0179938_11656501 | 3300019210 | Anaerobic Digestor Sludge | IMVTGPGDAAELLRRRKVLIPLKLKFITRKSNLQKQI |
| Ga0180106_10212201 | 3300019212 | Groundwater Sediment | DHGNWPGKATELLRRRKVLIPGKLKFITRKRSLQKPI |
| Ga0180106_10215671 | 3300019212 | Groundwater Sediment | DHGNWPGKATELLRRRKELIPEKLKFITRKRNLQKQI |
| Ga0180106_10240561 | 3300019212 | Groundwater Sediment | IMVTGLGEATKFLRRSKVLIPEKLKFLTRKSNLQMLI |
| Ga0180106_10689811 | 3300019212 | Groundwater Sediment | IMVTGPGDAAELLRRRKALIPEKLKFITRKGNLQKPI |
| Ga0180106_12029341 | 3300019212 | Groundwater Sediment | DHGNWPGKATELLRRREVPIPEKLKFVTRKSNLWKPI |
| Ga0180106_12485933 | 3300019212 | Groundwater Sediment | DHGNWPGKATELLRRREVLIPEKLKFKTRKSNLQKPI |
| Ga0179939_11243381 | 3300019216 | Anaerobic Digestor Sludge | IMVTGPGDATELLRRREVLIPEKLKFLTRKSNLQKPI |
| Ga0179934_12261931 | 3300019226 | Anaerobic Digestor Sludge | VTGPGDATELLRRREVLIPEKLKFLTRKSNLQKPI |
| Ga0179935_11919751 | 3300019231 | Anaerobic Digestor Sludge | VTGPGDAAELLRRRKVLIPLKLKFITRKSNLQKQI |
| Ga0180114_10263632 | 3300019232 | Groundwater Sediment | VTGPGEATELLRRREVLIPEKLKFITRKRNLQMPI |
| Ga0172288_10003511 | 3300019234 | Wetland | IMVTGPGEAAELLRRSGALIPETLKKITRKVNFWIRN |
| Ga0180111_11678201 | 3300019244 | Groundwater Sediment | IMVTGLGKATELLRRREVLNPEKLKFRTRKSNLQKLI |
| Ga0180111_14090992 | 3300019244 | Groundwater Sediment | IMVTGPGEATELLRRREVLIPEKLKFLTRKSNLQKPI |
| Ga0172287_13353711 | 3300019246 | Wetland | IMVTGPGEAAELLKRREVLIPKKLKYLTRKSDLQKLN |
| Ga0172287_14958151 | 3300019246 | Wetland | HGNWPGKATELLRRRKVLIPGKLKFITRKRSLQKPI |
| Ga0180117_14019952 | 3300019248 | Groundwater Sediment | DHGNWPGKATELLRRREALIPEKLKFKTRKSNLQKPI |
| Ga0172286_10390181 | 3300019252 | Wetland | HGNWPEKATELLRRRKVLIPGKLKFITRKRSLQKPI |
| Ga0172286_11289471 | 3300019252 | Wetland | IMVTGPGEAAELLKRREVLIPKKLMHLTRKSNLQKLN |
| Ga0172286_14183281 | 3300019252 | Wetland | IMVTGPGEAAELLRRREVPNPEKLKFITRKSNLLKPI |
| Ga0180113_10294191 | 3300020065 | Groundwater Sediment | HGNWPGKATELLRRREVLIPEKLKFKTRKSNLQKPI |
| Ga0180113_12539961 | 3300020065 | Groundwater Sediment | IMVTGPGEATELLRRREVLIPEKLKFITRKSNLQKPI |
| Ga0180108_10790292 | 3300020066 | Groundwater Sediment | GNWPGKATELLRRREVLIPEKLKFKTRKSNLQKPI |
| Ga0180108_12239002 | 3300020066 | Groundwater Sediment | VTGPGEATELLRRREVPIPEKLKFITRKSNLQKPI |
| Ga0210329_1064862 | 3300021257 | Estuarine | DHGNWPGKATELLRRREVLIPEKLKFITRKRSLQKPI |
| Ga0210329_1287293 | 3300021257 | Estuarine | VTGPGKATELLGRREVLDPEKLKFVTRKSNLRKRI |
| Ga0210345_1083201 | 3300021258 | Estuarine | MVTGPGEATELLRRREVLIPEKLKFITRKSNLQKLI |
| Ga0210345_1472492 | 3300021258 | Estuarine | IKVTGPGEATELLRRRKVLIPEKLKFLTRKSNLQKPI |
| Ga0210356_1151471 | 3300021269 | Estuarine | IMVTGPGEAAELLRRREVLIPRKLKFLTRKSNLQKPN |
| Ga0210356_1183641 | 3300021269 | Estuarine | DHGNWPGKATELLRRREVLIPEKLKFITRKRNLQKPI |
| Ga0210356_1190272 | 3300021269 | Estuarine | DHGNWPGKATELLRRREVLIPEKLKFTTRKRNLQKPI |
| Ga0210356_1214152 | 3300021269 | Estuarine | IMVTGPGEATELLRRREVLIPEKLKFITRKSDLQKPI |
| Ga0210356_1262441 | 3300021269 | Estuarine | IMVTSPGKAAELLRRREVLIPEKLKFLTRKSNLLKPI |
| Ga0210356_1695711 | 3300021269 | Estuarine | DHGNWPGKATELLRRSEVLIPEKLKFTTRKRNLLKPI |
| Ga0210356_1813891 | 3300021269 | Estuarine | IMVNGPGEATELLRRREVLIPKKLKFITRKSNLQKPI |
| Ga0210360_1088161 | 3300021270 | Estuarine | VTGPGKVAELLRRREVLIPEKLKSFNRKVNLQKPI |
| Ga0210340_10373781 | 3300021273 | Estuarine | DHGNWPGKATELLRRREVLIPEKLKFTTRKRNLRKPI |
| Ga0210340_10811001 | 3300021273 | Estuarine | IMVTGLGEAAELLRRREVLIPEKLKFITRKSNLQKPI |
| Ga0210340_10816331 | 3300021273 | Estuarine | IMVTGPGDAAELLRRREVLIPEKLKLITRKSDLQKPI |
| Ga0210340_11019861 | 3300021273 | Estuarine | IKVTGPGEATKLLRRREVPNPEKLKFITRKSNLQKPI |
| Ga0210354_10958122 | 3300021276 | Estuarine | IMVTGPGKVAELLRRREVLIPEKLKSFNRKVNLQKPI |
| Ga0210303_11093851 | 3300021282 | Estuarine | IMVTGPGEATELLRRREVLNPEKLKFITRKSNLLKPI |
| Ga0210355_10141811 | 3300021292 | Estuarine | IMVTGPGEDTELLRRREVLIPEKLKFLTRKSNLQKPI |
| Ga0210355_10619702 | 3300021292 | Estuarine | VTGPGEAAELLKRREVLIPKKLKHLTRKSNLQKLN |
| Ga0210358_1178331 | 3300021293 | Estuarine | IMVTGPGEAAELLRRREVLIPKTLKFVTRKSNLQKLI |
| Ga0210358_1917932 | 3300021293 | Estuarine | GNWPGKATELLRRREVLDPEKLKFITRKSDSQKPI |
| Ga0210325_12096982 | 3300021294 | Estuarine | VTGPGEAAELLRRREVLIPEKLKFITRKSNLQKPI |
| Ga0210308_10174571 | 3300021303 | Estuarine | DHGNWPGKATELLRRRDVLDPEKLKFITRKSDSQKPI |
| Ga0210331_11099651 | 3300021304 | Estuarine | IVVTNSGEDTELLQRSKVLIPEKPTFKTRKSNKRKQI |
| Ga0210326_11453011 | 3300021309 | Estuarine | IMVTNSGEDTELLQRSKVLIPEKPTFKTRKSNKRKQI |
| Ga0210362_11153421 | 3300021329 | Estuarine | MVTGPGEAAELLRRREVPIPEKLKFITRKSNLQKPI |
| Ga0210305_10975612 | 3300021847 | Estuarine | GNWPGKATELLRRREVLDPEKLKFVIRKSNLQKTI |
| Ga0210305_11160561 | 3300021847 | Estuarine | IVTGPGEAAELLRRREVLIPEKLKFITRKSNLQKPI |
| Ga0210304_10438381 | 3300021849 | Estuarine | HGNWPGKATELLRRSEVLIPEKLKFTTRKRNLLKPI |
| Ga0210304_10968301 | 3300021849 | Estuarine | DHGNWPGKATELLRRREVLDPEKLKFITRKSDSQKPI |
| Ga0210323_10878191 | 3300021853 | Estuarine | IMVTGLGKAAELLRRREVLNPEKLKFRTRKSNLQKLI |
| Ga0213854_13958971 | 3300021855 | Watersheds | IMVTGPGEATELLRRREVPNPEKLKFITRKSNLQKPI |
| Ga0213853_112188081 | 3300021861 | Watersheds | EIMVTGPGEAAELLKRREALIPEKLKFITRKSNLWKPI |
| Ga0213857_10115011 | 3300022171 | Watersheds | IMVTGPGEATELLRRREVLIPEKLKFLTRKSDLQKPI |
| Ga0213857_10286511 | 3300022171 | Watersheds | RDHGNWPGKATELLRRREVLIPEKLKFTTRKRNLQKPI |
| Ga0213857_10352021 | 3300022171 | Watersheds | IMVTGPGEATELLRRREVLIPEKLKFKTRKSNLQKPI |
| Ga0079039_10432221 | 3300022185 | Freshwater Wetlands | IMVTGPGEAAELLRRRKVLIPEKLKFITRKSNLQKLI |
| Ga0079039_12679641 | 3300022185 | Freshwater Wetlands | VMVTGPGEATELLRRRDVLIPKKQKFVTRKSNLQKPI |
| Ga0079039_13711082 | 3300022185 | Freshwater Wetlands | IMVTGPGEATELLRRREVLIPEKLKFVTRKSYLQKPI |
| Ga0210375_1041141 | 3300022363 | Estuarine | IMVTGPGEAAELLRRREVLIPKKLKFITRKSNLQKPI |
| Ga0210346_1083831 | 3300022368 | Estuarine | MVTGLGEAAELLRRREVLIPEKLKFITRKSNLQKLI |
| Ga0210346_1132611 | 3300022368 | Estuarine | IMVTSPGEAAELLRRREVLIPMKLKFLTRKSDLQKPI |
| Ga0210346_1159821 | 3300022368 | Estuarine | IMVTGPGEAAELLKRREVLIPKKLKHLTRKSNLQKLN |
| Ga0210346_1162292 | 3300022368 | Estuarine | IKVTGPGEATELLRRREVLIPEKLKFLTRKSNLQKPI |
| Ga0210376_10249851 | 3300022385 | Estuarine | IMVTGPGDAAELLRRREVLIPEKLKFITRKSNLQKPI |
| Ga0255222_10303771 | 3300024487 | Freshwater | EIMVTGPGEATELLRRREVLIPEKLKFLTRKSNLQKPI |
| Ga0255248_10383032 | 3300025742 | Freshwater | GNRPGKATELLRRREVLIPKKLKFITRKSNLQKPI |
| Ga0255250_11494681 | 3300025763 | Freshwater | HGNWPGKATELLRRREVLIPEKLKFITRKRNLPKPI |
| Ga0208980_100424153 | 3300027887 | Wetland | MVTGPGEAAELLRRREERNPEELKLITRKSDLLKPI |
| Ga0209668_108052831 | 3300027899 | Freshwater Lake Sediment | MVTGPGEAAELLRRREVPNPEKLKFITRKSNLLKPI |
| Ga0255259_10468642 | 3300028078 | Freshwater | GNWPGKATELLRRREVLIPEKLKFTTRKRNLLKPI |
| Ga0256324_10320411 | 3300028080 | Freshwater | DHGNWPGKATELLRRREVLIPEKLKLTTRKRNLLKPI |
| Ga0265593_10480893 | 3300028178 | Saline Water | MVTGPGEATELLRRREVLIPEKLKFITRKSNLQKQI |
| Ga0256316_10757482 | 3300028261 | Freshwater | GNWPGKATELLRRSEVLIPEKLKFTTRKRNLLKPI |
| Ga0210315_10591102 | 3300028329 | Estuarine | VTGPGEAAELLRRREALIPEKLKFITRKSNLQKPI |
| Ga0257142_10427611 | 3300028621 | Marine | IMVTGPGEATELLRRREVLIPEKLKFITRKSNLQKQI |
| Ga0257141_10437561 | 3300028623 | Marine | IMVTGPGEAIKLLRRREELNPNKQKSFTRKRKLQS |
| Ga0272412_11911651 | 3300028647 | Activated Sludge | IMVTGLGEAAELLRRREVLNPEKLKFITRKSNLQKLI |
| Ga0265604_1135592 | 3300029674 | Marine | VTGPGEATELLRRREVLIPEKLKFITRKSNLQKQI |
| Ga0265603_10182051 | 3300029685 | Marine | DEIMVTGPGEATELLRRREVLIPEKLKFITRKSNLQKQI |
| Ga0265602_10180861 | 3300029687 | Marine | RPHEIMVTGPGEATELLRRREVLIPEKLKFITRKSNLQKQI |
| Ga0265602_10232981 | 3300029687 | Marine | EIMVTGPGEAIKLLRRREELNPNKQKSFTRKRKLQS |
| Ga0256301_10584161 | 3300029697 | Freshwater | EIMVTGPGEATELLRRREALNPKKLKFITRKSNLLKPI |
| Ga0256301_10807361 | 3300029697 | Freshwater | IMVTGPGKAAELLRRREVPDPEKLKFITCQSDLQKPI |
| Ga0302286_104154691 | 3300030047 | Fen | ISPDEIMVTGPGEAAELLRRREVLIPEMLKFITRKSNLQKLI |
| Ga0373897_116548_115_225 | 3300034080 | Sediment Slurry | MVTGLGEAAELLRRSGALIPETLKKITRKVNFWIRN |
| Ga0316598_085401_749_871 | 3300034652 | Untreated Peat Soil | ALIHDRDWAGKATELLRRREVLIPEKLKFKTRKSNLQQPI |
| Ga0316598_086835_5_115 | 3300034652 | Untreated Peat Soil | MVTGPGETIELLKRREVVIPEKLKYLTRKRNLLKQI |
| Ga0316598_090612_4_114 | 3300034652 | Untreated Peat Soil | MVTGPGEAAELLRRREVLNPEKLKFITRKSNLQKLI |
| Ga0316598_097846_1_120 | 3300034652 | Untreated Peat Soil | LPILVTGPGDADELLRRREALIPEKLKFITRKSNLQKPI |
| Ga0316598_097989_8_118 | 3300034652 | Untreated Peat Soil | MVTGPGDADELLRRREALIPEKLKFTTRKSNLQKLI |
| Ga0316598_166454_1_114 | 3300034652 | Untreated Peat Soil | DHGNWPGKATKLLRRREVLIPEKLKFITRKRNLPKPI |
| Ga0316599_077519_744_854 | 3300034653 | Untreated Peat Soil | MVTGPGDAAELLRRREVLIPEKLKFVTRKSNLQKPI |
| Ga0316599_077705_1_114 | 3300034653 | Untreated Peat Soil | DHGNWPGKATELLRRREVLIPEKLKFITRKSNLQKPI |
| Ga0316599_088366_697_804 | 3300034653 | Untreated Peat Soil | VTGPGEAAELLRRREVLIPEMLKFITRKSNLQKLI |
| Ga0316599_159399_1_111 | 3300034653 | Untreated Peat Soil | MVTGPGEATELLRRREVLIPEKLKLIIRKSNLQKLI |
| Ga0316599_175880_2_109 | 3300034653 | Untreated Peat Soil | VTGPGEATELLRRREVLIPEKLKFITRKSNLQKLI |
| Ga0370497_0121008_41_151 | 3300034965 | Untreated Peat Soil | MVTGPGDAAELLRRREVLIPEKLKFLTRKSNLQKPI |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |