NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032918

3300032918: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032918 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330580 | Ga0314726
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size54159075
Sequencing Scaffolds29
Novel Protein Genes35
Associated Families32

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum3
Not Available13
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes1
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum6
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3941Long. (o)-85.3741Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000459Metagenome / Metatranscriptome1109Y
F000927Metagenome / Metatranscriptome831Y
F001705Metagenome / Metatranscriptome648Y
F010664Metagenome / Metatranscriptome300Y
F014470Metatranscriptome262Y
F016911Metagenome / Metatranscriptome243Y
F018302Metagenome / Metatranscriptome235Y
F019940Metagenome / Metatranscriptome226Y
F020484Metagenome / Metatranscriptome223Y
F023769Metagenome / Metatranscriptome208Y
F025200Metagenome / Metatranscriptome202Y
F026763Metagenome / Metatranscriptome196Y
F027091Metagenome / Metatranscriptome195Y
F030953Metatranscriptome183N
F032552Metagenome / Metatranscriptome179Y
F040723Metagenome / Metatranscriptome161Y
F042357Metagenome / Metatranscriptome158Y
F046814Metagenome / Metatranscriptome150N
F050083Metagenome / Metatranscriptome145Y
F053032Metagenome / Metatranscriptome141Y
F056279Metagenome / Metatranscriptome137Y
F065372Metagenome / Metatranscriptome127Y
F067332Metagenome / Metatranscriptome125N
F069562Metagenome / Metatranscriptome123Y
F072944Metagenome / Metatranscriptome120Y
F074257Metagenome / Metatranscriptome119Y
F079533Metagenome / Metatranscriptome115N
F089752Metagenome / Metatranscriptome108N
F093055Metagenome / Metatranscriptome106Y
F094644Metagenome / Metatranscriptome105N
F100085Metatranscriptome102N
F100243Metagenome / Metatranscriptome102Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314726_100839All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum2425Open in IMG/M
Ga0314726_101295All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum2145Open in IMG/M
Ga0314726_103065Not Available1661Open in IMG/M
Ga0314726_103817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays1543Open in IMG/M
Ga0314726_105884Not Available1321Open in IMG/M
Ga0314726_107233All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1222Open in IMG/M
Ga0314726_108609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax1134Open in IMG/M
Ga0314726_115862All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes852Open in IMG/M
Ga0314726_116071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum847Open in IMG/M
Ga0314726_120467All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae746Open in IMG/M
Ga0314726_121943All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae719Open in IMG/M
Ga0314726_122065Not Available716Open in IMG/M
Ga0314726_122820Not Available703Open in IMG/M
Ga0314726_124121Not Available681Open in IMG/M
Ga0314726_124311Not Available678Open in IMG/M
Ga0314726_125327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum662Open in IMG/M
Ga0314726_125939Not Available653Open in IMG/M
Ga0314726_126444All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
Ga0314726_128124Not Available622Open in IMG/M
Ga0314726_128135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum622Open in IMG/M
Ga0314726_128795All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
Ga0314726_130142All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum598Open in IMG/M
Ga0314726_131874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta578Open in IMG/M
Ga0314726_132241Not Available574Open in IMG/M
Ga0314726_134271Not Available554Open in IMG/M
Ga0314726_134542Not Available551Open in IMG/M
Ga0314726_137135Not Available527Open in IMG/M
Ga0314726_138058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
Ga0314726_139125Not Available510Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314726_100355Ga0314726_1003552F094644MKFIFLLXALRYQRYHSGIWHHCYCCSMPTKCSLHSGYCHTCALRLLCNSNTWILQIXGKDIHLPFASPSSGFQQRMXYCQNHKXLFTHSFIKDLRSMAIYIRMDALECGYHFPSENDQVXQISHFNKSVIVQIHEHRNAKSNIWLNYTSNSLETSEFFGIFXSSLQQATLEKVYISIGNNISLNSYYHMWYVVHYKNIMYLRHDIHILLPCLYMGFNQIEMKHV
Ga0314726_100839Ga0314726_1008391F010664MVLLQMDDNNAANHGNGGQEAQPPPPPSLAQAIAALIADRNEQTELLRQLVESHAGRGRQAPPAETDYVGFFATQPPLFHKANDPLEADAWIRTIE
Ga0314726_101295Ga0314726_1012951F074257MGGVRIPVLFHWRESAEYDRAEFFSPKGKRVGVGSDKDKFSISLAISGRIISAEVISPSCSRRGVSVLAGSIRWLEKPPDPLAMQTHEPNTKVVPALIAGKLNSKDAIKFFC
Ga0314726_102614Ga0314726_1026141F000459VDNVKRGRGRSKLTWDESVKRDLKDWNISKEIALDRSAWRLAINVPEP
Ga0314726_103065Ga0314726_1030652F089752GSAPAGRVLRGARLFCFVCSGDKTCPRAEGGQGDDGACCSAAGAFVVLSRASGHRPWLPWLLCGAPFEGGRPEPMLRRSASRGSAPLYFVRSRLGVVTEGIFCPWSAVSSRATQASAFRQAWSLVPGTAINRGRGVSPSSPASQLFLPALPKSCNVSFAFS
Ga0314726_103817Ga0314726_1038173F065372VHPTARHSAPDCREIQKLVRRVSGRREQSSKDGSPPPRQRAGKEKASDSGAAAGEKELGYQSPARELKGVYHNDDSDSDNGDRRKKLYVMYGRSWELVSRRDVKTLRREVL
Ga0314726_105884Ga0314726_1058842F067332MPPSVHVYCHIIMLANFGEEEIRRACIIISSCVEFWVVFLVHPILTRSLRAYIAVLKFCAALLSIQLLAIQIIFLEKLDYEKDMRNYRFTYYRNFNDLRGMFIWISRLNLALDPVPSMLIVTTQ
Ga0314726_105943Ga0314726_1059431F093055HALQEGSHANLPVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTKL
Ga0314726_107233Ga0314726_1072333F032552VIVGLAISCSKIGQKPAKTKYLQNICANAKTTNNWAEVRMVSDFDIKFMPLSK
Ga0314726_108609Ga0314726_1086091F019940KTTHDICHHIFMFDGRDKNINSQTNSSTKHILNTYGGVMQNEIYCN
Ga0314726_115862Ga0314726_1158621F100243GFLLKASREIIVSRADVVSGSVLARKCVPPHGTVVVGGKW
Ga0314726_116071Ga0314726_1160711F025200LRPLHVGDDVLGHPNGAVPTTFLLPNLVSNHLAICFHLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLI
Ga0314726_120467Ga0314726_1204671F014470FPEEMVRITGRDPTPVEQEALRAVQWRHGRWGGSKRDVFSPTCGKVRRSYHYRAQPGFSYLSFVGPGKTKLSPLWEKGADWGLVPADFRSEEEERGLAKLEQFRADWDSGFIAIGD
Ga0314726_121943Ga0314726_1219431F023769LKETLLTWSMPCADLHKNAFQRSSSRVAHVTRPVDNSTSGSTVKRCRDCLRGERDTKETIHNGLLLLRVGYGLPYSELPDCSPGDLSRFLSFLLLQGKERTSVAFPRRQRHGENGLCTLQRLCRRDRWALAHGCSSIKRNLPKGCFRHTPSVFAAWEAAALSQPPPLTSGYLEHVRRVVTGIFRPGWDGRYNSFVGSHVPNPSARACKTRADVLWRRRRDEFFTATTSESDINPSELSG
Ga0314726_122007Ga0314726_1220071F100085RGPLAYRATRRFGLSTTVTHTPIPSLVVDNGLSLAASGCEFVDPLELSDEDKERNLCELAAWKWRTKFNISDQCRSNLRFMLAVSATRVDRPDFRPLFWGSDSCLLTRKWHSAKMFRKPIEKRERGFPVLAGYAGRLPSYEEVLAGETDVGSVELIVKADKKN
Ga0314726_122065Ga0314726_1220651F046814MRRNRTYPYNWVVVKEKDNKQDNLGFGFWNPVDLMSCSNEEFSLPNIDGASNSEMKNTDTIIAQN
Ga0314726_122820Ga0314726_1228201F079533SREEARVSTQLVLNKYNTNYEALRLADSTALAFKYWQIFIKAIYYKLMNYL
Ga0314726_124121Ga0314726_1241211F016911VLTVQGDRTAAVAAVERLHTLAAEAARPEEDPSTSQPRAPAKAPKVQPSDPDQVPVKTVQIGADSTRTTRIAGNLEEK
Ga0314726_124311Ga0314726_1243111F056279MTSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELDV
Ga0314726_125327Ga0314726_1253271F027091GALIAQPVFGLCNSSSVYKQMIRSSYENSSDRLLHVENQSATASREAPVFDVYPDPIESSQDSLDFITNALIKMQLKSCRDHTLAELLDNLREVASIDDLPFQHGAPLVTERETGSGRTVLADYGSDLESFSHERLVPVIIQHGEAPSHHDPNRDLDQISADNLTQDAPGDEDEVTRTAHRERNQRKEVRRTRAAERAHLPPCNLNNEFNNAADPIFRTP
Ga0314726_125939Ga0314726_1259391F072944XTKKNKILNKIKSTESYTRDMVLKFLPEPSHELKILQKNYQALSQQDKLVMHLTYHELA
Ga0314726_126444Ga0314726_1264441F018302LHEMRRQMHEASLTAINLGKGGRVLALPDGHQQSRGSAAVYMREQGVVSTVGELQLCGSGSFRFVTGEDAQFSATTFRYRPPRGPLRWSWSRLIPGGRTRAPLSFRWSPWDLGGYIHAGPACGECPPYLQQSKIKSRSLFKISRDVKGLFLGVRFASSGVIVRLQLEDELPMLLAR
Ga0314726_128124Ga0314726_1281241F000927MDYSSCFIFLYRMFNMGSGATNFMEGTSKHKLSTEIFPDFIHLYSRGDKKIKNSKPFTKINSTERFTEDLVLKFLPETIHEINILQ
Ga0314726_128135Ga0314726_1281351F042357MDLKPTRNSLGRNPLSDAPHRNPGVVISGQGPGRHPTNGASYRDLGMMISEQGLGRHLSGALHLRPGVVINEQGSSHFPRRVRRVRKLAEPTRIRIVSWNVGSLTGKL
Ga0314726_128795Ga0314726_1287951F069562LLLLDFLNSNLGPQLCESNAPKWLGEDVPKLSSSLDMLELDLSTIDAVTDEVILGVDVLAPVMVDGVLC
Ga0314726_129839Ga0314726_1298391F030953TVQDYPSGYRLNNDKTIRAGNAAEVNSTVFLKSKERWREVRHLRRGGAVTDFPGMMHMAKAVTVAPGFVDAYQRCRIGRRWGFLPSQLGHTTYPAYKRERGLRVRRTYTPLPEPADGCVFPEEMVRITGRDPTPVEQEALRSVQWKHGRWGGAKRDVFSPSCGKVRRSYQYRARPGFAYLSFVGPGRPKLSPLWEKGADW
Ga0314726_130142Ga0314726_1301421F050083VANSIIFITDSIVVSHIDDMENDMTVDLAMTWIAMMTWSLTWLLTCQ
Ga0314726_131788Ga0314726_1317881F000459VRSGVLERVDNVKRGRGRPKLTWDESAKRDLKDWNISKEIALDRSGWKLAINVLEP
Ga0314726_131874Ga0314726_1318741F001705RPKLTWDESVKRDLKDCNISKEIALDRSAWRLAINVPEH
Ga0314726_132241Ga0314726_1322411F040723MSFHSYMIVFCALFQWDRELPILDPVAXVIAFKLHGEGIQGSQALSIVLQGXAPDKSFLYGLSRQV
Ga0314726_134271Ga0314726_1342711F020484MARTLDAAHSEIRNRLQRWDKMDTTLLFGINFGRIRTRWKEKFVHFTMEQCFSTCSVLEIERKIREDEAAMRQRGIEGGDDNMKQ
Ga0314726_134542Ga0314726_1345421F053032SPRKSSCSILHRNFSFSLNTLWQDQASPLEMSVLGHPEIGNPKDVTQQDPTQRPQICLIGRCKDMMSRMDPMRAWEWQDEVAGTSLVTRKFSSSIFCWKGLHKLQEGESKNTKDKPWPLHFGASGKGLSPTFYSYKGAY
Ga0314726_137135Ga0314726_1371352F020484MTRTLDVVCSEIRRDRLQRWDEMGITLLFGINFGRMRTRWKVKFVHFTIEQCFSTCSILEVERKIHEDETTMGQRGIEGGDDDVKQ
Ga0314726_138058Ga0314726_1380581F026763VCIASGSGSFDSHLTNSPTLKAASPESLGKLAESDDQGIMLLPYLTKEIEMKLEDNLGSTRTQIDLKLISTRIGTPLAQPLFGLRNSSSTYKQMIRSIYENSLDHLLCGKNHSVTASREAPIFDIYPDPVESSQDSLDFITNALVKIQLESCESHTLAELLDNLRKVASIDD
Ga0314726_139125Ga0314726_1391251F067332MPPSIHVYCHIIIWANFGEDEIRRACIIISSCVEFWVVFLVHPILTHSLRAYIAVLKFCDALISVQLLAIQIIFPKKLDYERDVRSYRFTYYRSFNNLM

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.