| Basic Information | |
|---|---|
| Family ID | F093055 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 106 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LPVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTKL |
| Number of Associated Samples | 68 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 68 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (100.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (78.302 % of family members) |
| Environment Ontology (ENVO) | Unclassified (96.226 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (81.132 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.00% β-sheet: 0.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF13855 | LRR_8 | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 100.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 78.30% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 10.38% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 4.72% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.89% |
| Rumen | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen | 0.94% |
| Fungi-Associated Bovine Rumen | Host-Associated → Mammals → Digestive System → Foregut → Unclassified → Fungi-Associated Bovine Rumen | 0.94% |
| Switchgrass Degrading | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300009872 | Cow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Switchgrass. Combined Assembly of Gp0148675, Gp0148676 | Host-Associated | Open in IMG/M |
| 3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
| 3300009977 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG | Host-Associated | Open in IMG/M |
| 3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
| 3300009994 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012949 | Switchgrass enrichment cultures co-assembly | Engineered | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028149 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028523 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300031118 | Coassembly of Cow X and Y Switchgrass | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032843 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032845 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032918 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032959 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0130079_135154891 | 3300009872 | Rumen | EGSHANLSVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTEL* |
| Ga0105136_1030001 | 3300009973 | Switchgrass Associated | VGIVLAGKYRDLTKTLHGRQVVFEPVKVLKTSTKL* |
| Ga0105141_1235801 | 3300009977 | Switchgrass Associated | GIVLARKYRDLPKTRHGRQVVFELVKVLKTSTKL* |
| Ga0105135_1007752 | 3300009980 | Switchgrass Associated | LLVGIVLAGKHGDLIKTRHGRQVVFEPVKVLKTSTKL* |
| Ga0105135_1084671 | 3300009980 | Switchgrass Associated | GIVLAGKHQGLPKTRHGHQVVFEPIMVLKTSTML* |
| Ga0105133_1008172 | 3300009981 | Switchgrass Associated | PVGIVLAGKHRDLTKTRHGRQVIFEPVKVLKTSTKL* |
| Ga0105133_1144151 | 3300009981 | Switchgrass Associated | DLGSHALQEVSHANLLVGIVLARKHRDLPKTHQGRQVVFEPVKVLKTSTKL* |
| Ga0105120_10176231 | 3300009992 | Switchgrass Associated | LPISIVLAGKHRDLTKTRHGRQMVFEPVKLLKTLTLL* |
| Ga0105120_10552871 | 3300009992 | Switchgrass Associated | DIPDLGSHALQEGTHANLPISIVLAGKHWDLTKTRHGRQVIFEPVKVLKTSTKL* |
| Ga0105120_10561401 | 3300009992 | Switchgrass Associated | LVGIVLARKHRDLTKTRHGRQVVFEPVKVLKTSTKL* |
| Ga0105126_10500431 | 3300009994 | Switchgrass Associated | EDSHADLPISIILAGKHRDFTKARHGRQVVFEPVKVLKTSTKL* |
| Ga0105139_11152531 | 3300009995 | Switchgrass Associated | ALQEGSHANLPLGIILAGKHRDLTKTRHGRRVVFELVKVLKTSTKL* |
| Ga0134125_126888662 | 3300010371 | Terrestrial Soil | VLGDIPDLGSHALQKGTHANLLISIVLAEKHWDLTKTRHGRQVIFEPVKVLKTSTKL* |
| Ga0134121_121071852 | 3300010401 | Terrestrial Soil | LPISIVLAGEHWDLTKTRHGRQVVFEPVKVLKTSTKL* |
| Ga0153798_102577291 | 3300012949 | Switchgrass Degrading | ALQEGPHANLSVGIVLADKHRDLTKTRHGRQMVFEPVRVMKTLTKL* |
| Ga0182183_10234631 | 3300015270 | Switchgrass Phyllosphere | NLGSHALQEGSHANLPVGIVLAGKHRDLPKTLHGRQVVFEPVKVLKTSTKL* |
| Ga0182100_10426832 | 3300015280 | Switchgrass Phyllosphere | LGDLPKLGSHTLQEGSHTHLPVSIVLAGKHGDLTKTLYGRQVVFEPVKVLKTSTKL* |
| Ga0182101_10311301 | 3300015284 | Switchgrass Phyllosphere | GIILAGKYRDLTKTRHGRRVVFEPVKVLKTSTKL* |
| Ga0182105_10030241 | 3300015290 | Switchgrass Phyllosphere | LQEGMHSNLLVGIVLAGKHRDFTQTRNGRQVVFDPVRVIKTLTKL* |
| Ga0182103_10154061 | 3300015293 | Switchgrass Phyllosphere | LPISIVLARKHRDLPKTCHGRQVVFEPVRVMKTLIKL* |
| Ga0182103_10219981 | 3300015293 | Switchgrass Phyllosphere | GNIPDLGSHTLQEGSHANLSVGIVLAGKHRDLPKTRHGRQVVFDPVKVLKTSTKL* |
| Ga0182103_10407811 | 3300015293 | Switchgrass Phyllosphere | SHALQEGSHANLPVGLVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTKF* |
| Ga0182184_10970101 | 3300015301 | Switchgrass Phyllosphere | GIVLAGKHRDLTKTRHGRQVVFEPVKVLKTSTKL* |
| Ga0182180_10192571 | 3300015306 | Switchgrass Phyllosphere | LQEGSHPNLPVSIVLTGKYRDLPKTRYGREVVFEPVKVLKTSTEL* |
| Ga0182098_10704951 | 3300015309 | Switchgrass Phyllosphere | NLPVGLILAGKHRDLTKTRHGRRVVFEPVKVLKTSTEL* |
| Ga0182162_10099401 | 3300015310 | Switchgrass Phyllosphere | EGTHANLLISIVLIGKHWDLTKTRHSRKVVFELVKVLKTSTKY* |
| Ga0182182_10134611 | 3300015311 | Switchgrass Phyllosphere | SMVLAGKHRDLTKTRHSRQVVFEPVKVLKTSIKL* |
| Ga0182182_10745342 | 3300015311 | Switchgrass Phyllosphere | GIVLAGKHRDLPKTRHGRQVVFEPVKVLKTSTKL* |
| Ga0182182_10828161 | 3300015311 | Switchgrass Phyllosphere | SIVIAGKHWDLTKTRYGRQVVFEPVKVLKTLTKL* |
| Ga0182164_10389991 | 3300015313 | Switchgrass Phyllosphere | NLGSQALQENPHANLPVSIVLAGKHRDFTKTYHGRQRVFEPVRVMKTLTKL* |
| Ga0182164_10414571 | 3300015313 | Switchgrass Phyllosphere | SIVLAGKYRDLTKTHHGRQMVFEPVKVLKTLTKL* |
| Ga0182164_10540721 | 3300015313 | Switchgrass Phyllosphere | ISIVLASKHRDFTKTRHSRQMVFEPVKVLKTLTKL* |
| Ga0182164_11063071 | 3300015313 | Switchgrass Phyllosphere | PNLGSHALQEGSHANLLISIVLAEKHGDLSKTCHGRQVVFEPVKVLKTSTKL* |
| Ga0182120_10543311 | 3300015315 | Switchgrass Phyllosphere | LQKSPHANLLVGIVLTGKHRDLTKTLHGRQMVFEPVRVMKALTKL* |
| Ga0182120_11254901 | 3300015315 | Switchgrass Phyllosphere | PYLGSHALQESSHANLLVGIVLAGKHWNLTKTRHGRQVVFEPVKVLKTSTKL* |
| Ga0182121_10367681 | 3300015316 | Switchgrass Phyllosphere | ANLPIGIVLAGKHRDLTKTRHGRQVVFEPVKVLKTSAKL* |
| Ga0182165_10047411 | 3300015320 | Switchgrass Phyllosphere | LPVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTKL* |
| Ga0182165_10814711 | 3300015320 | Switchgrass Phyllosphere | PVGIVLAGKHRDLTKTRHGHQVVFEPVKLLKTSTKL* |
| Ga0182134_10726001 | 3300015324 | Switchgrass Phyllosphere | ANLPVSIILAEKQQDLTKTRHDRLVVFEPVKVLKTLTKL* |
| Ga0182134_10950771 | 3300015324 | Switchgrass Phyllosphere | PVGIILAGKHRDLTKTRHGRRVVFEPVRVLKTSTEL* |
| Ga0182148_10298792 | 3300015325 | Switchgrass Phyllosphere | SHANLPVGIVLAGKHRDLTKTRYGRQVVFEPVKVLKTSTKL* |
| Ga0182148_11089822 | 3300015325 | Switchgrass Phyllosphere | ANLPVGIVLAGKHRDLPKTRRGRQVVFEPVKVLKISTKL* |
| Ga0182114_10567321 | 3300015327 | Switchgrass Phyllosphere | RIVLAGKDRDLPKTRHGRQVVFEPVRVMKTLTKL* |
| Ga0182114_11071911 | 3300015327 | Switchgrass Phyllosphere | SNLGSQALQEGPHANLPVGVVLAGKHRDLTKTCHGRLMVFEPVRVMKTLTKL* |
| Ga0182153_10138451 | 3300015328 | Switchgrass Phyllosphere | SIVLAGKYRDLTKTRHGRQMVFEPVKILKTLTKLQIKY* |
| Ga0182153_11129021 | 3300015328 | Switchgrass Phyllosphere | GIVLAGKYRDLTKTRHGRRVVFEPVKVLKTSIEL* |
| Ga0182152_10526581 | 3300015330 | Switchgrass Phyllosphere | ANLPVGIVLASKHRDLTKTLYGRKMVFEPVRVMKTLTKL* |
| Ga0182117_11438211 | 3300015332 | Switchgrass Phyllosphere | PNLGSYALQEGSHANLPISIVLVGKHRDLPKTCHGRQVVFELVRVMKTLTKL* |
| Ga0182117_11638881 | 3300015332 | Switchgrass Phyllosphere | LPISIVLAGKHSDLTKTRDGRQMVFEPVKVLKTLTKL* |
| Ga0182117_11662011 | 3300015332 | Switchgrass Phyllosphere | PISIVLAGKHWDLTKTRYGRQVVFEPVKILKTSTKL* |
| Ga0182132_10604082 | 3300015334 | Switchgrass Phyllosphere | VSLVLGDLPNLGSHALQEVSHTHLPISIVLAGKHRDLTKTRHGRQMIFELVKVLKTSTKL |
| Ga0182132_10910472 | 3300015334 | Switchgrass Phyllosphere | HANLLVGIVLAGKHRDLTKTRHGRRVVFELVKVLKTSTEC* |
| Ga0182132_11648681 | 3300015334 | Switchgrass Phyllosphere | PVGIVLAGKHRDLTKTRHGRQVVFEPVEVLKTSTKL* |
| Ga0182116_11141981 | 3300015335 | Switchgrass Phyllosphere | ANLLVSIVLVGKHRDLTKTCHGRQMVFEPIRVMKTITKL* |
| Ga0182116_11658711 | 3300015335 | Switchgrass Phyllosphere | GIVLAGKHQDLTKTRHGRRVVFEPVKVLKTSTKL* |
| Ga0182116_11781601 | 3300015335 | Switchgrass Phyllosphere | LPVGIVLAGKHWDLPKIRHGRQVVFEPVKVLKTSTEL* |
| Ga0182150_10587991 | 3300015336 | Switchgrass Phyllosphere | GIVLAGKHRDLTKTCHGRQMVFEPVRVMKTLTKL* |
| Ga0182150_10816301 | 3300015336 | Switchgrass Phyllosphere | SKVLAGKHWDLTKTRQGRQVVFELVKVLKTSTKL* |
| Ga0182150_11413961 | 3300015336 | Switchgrass Phyllosphere | QEGMHVNLPISIVLAGKHWDFTKTRHGRQEVFEPVRVLKTLTLL* |
| Ga0182151_10721901 | 3300015337 | Switchgrass Phyllosphere | ALQEGSHANLSVGIILAGKHGDLTKTRHGRRMVFEPVKVLKTSTKL* |
| Ga0182137_10187393 | 3300015338 | Switchgrass Phyllosphere | ANLPVGIVLAGKHRDLTKTPHGRQVVFEPVKVLKTSTKL* |
| Ga0182137_11574331 | 3300015338 | Switchgrass Phyllosphere | HVSLVLGNIPDLGSHALQEDSHANLLVGIVLAGKHGDLTKTCHGRQVVFEPVRVMKTLTKL* |
| Ga0182133_10107151 | 3300015340 | Switchgrass Phyllosphere | GIVLAGKHRDLTKTPHGRQVVFEPVKVLKTSTKL* |
| Ga0182133_10115831 | 3300015340 | Switchgrass Phyllosphere | PVGIVLAGKHGDLTKTRHGRQVVFEPVKVLKTSTKL* |
| Ga0182115_10621001 | 3300015348 | Switchgrass Phyllosphere | DLSNLGSHALQKGSHTHLPISIVLTGKHRDLTKTRHGRQVVFEPVKVLKTSTKL* |
| Ga0182115_10995131 | 3300015348 | Switchgrass Phyllosphere | LPISIVLAGKHSDFTKTRHGRQMVFEPVKVLKTLTLL* |
| Ga0182115_11444921 | 3300015348 | Switchgrass Phyllosphere | LQEGSHADLPISIVLTGKDRDLRKTLHGRQVVFELVRVMKTLTKL* |
| Ga0182185_10746913 | 3300015349 | Switchgrass Phyllosphere | NIVLAGKHRDLTKTRHGREVVFEPVKVLKISTKL* |
| Ga0182185_11855251 | 3300015349 | Switchgrass Phyllosphere | LVLGDIPDLGSHALQEGTHANLPISIILTEKHWDLTKTHHGRKVVFEPVKVLKTSTKL* |
| Ga0182169_10799981 | 3300015352 | Switchgrass Phyllosphere | HANLPISIVLAGKHKDLPKTCHGSQVVFELVRVMKILTKL* |
| Ga0182169_13157221 | 3300015352 | Switchgrass Phyllosphere | LQEGSHANLPVGIVLARKHRDLPKTRHGRQVIFEPVKVLKTSTKL* |
| Ga0182179_11253911 | 3300015353 | Switchgrass Phyllosphere | PISIVLAGKHRDLTKTRHGRQMVFEPIKVLKTLTKL* |
| Ga0182179_12013441 | 3300015353 | Switchgrass Phyllosphere | HANLPISIVLAGKHWDLTKTRQVVFELVKVLRTSTRL* |
| Ga0182179_13124971 | 3300015353 | Switchgrass Phyllosphere | GIVLTGKYRDLTKTRHGRRVVFEPVKVLKTSTKL* |
| Ga0182167_12681191 | 3300015354 | Switchgrass Phyllosphere | HALQEGSHANLPVGIVLAGKYRDLPKTRHGRQVVFELVKVLKTSTKL* |
| Ga0182167_12990111 | 3300015354 | Switchgrass Phyllosphere | SILLAGKHGDLTKTRHGRQVIFEPVKVLKTSTKL* |
| Ga0182196_11104951 | 3300017432 | Switchgrass Phyllosphere | NIPDFGSHALQEGSHANLPVGIVLAGKYRDLPKTRQVVFEPVKVLKTSTRL |
| Ga0182214_10353622 | 3300017440 | Switchgrass Phyllosphere | NIPDLGSHALQESSHANLPVGIVLAGKYGDLPKTRHGHQVVFEPVKVLKTSTKL |
| Ga0182198_10509951 | 3300017445 | Switchgrass Phyllosphere | GNIPDLGSHALQEDSHANLLVGIVLAGKHGDLTKTCHGRQVVFEPVKILKTSTKL |
| Ga0182198_11303231 | 3300017445 | Switchgrass Phyllosphere | ANLPISIVLAGKYWDLPKTRHGHQVIFKPVKVLKTSTRL |
| Ga0182215_10317491 | 3300017447 | Switchgrass Phyllosphere | GSHANLPISIVLAGKHGDLSKTRHGRQMVFELVKVLKTSTRL |
| Ga0182216_10390371 | 3300017693 | Switchgrass Phyllosphere | HANLPISIVLAGKHWDLTKTRHDRQVVFEPVKVLKTSTKL |
| Ga0182216_10954591 | 3300017693 | Switchgrass Phyllosphere | ANLLVSIVLTGKYRDFTKTCHGRQMVFELVRVMKALTKL |
| Ga0182211_11050431 | 3300017694 | Switchgrass Phyllosphere | ANLPISIVLVEKYWDLSKTRHGHQVVFEPVKVLKTPTKL |
| Ga0182211_11597221 | 3300017694 | Switchgrass Phyllosphere | GSYTHLPISIVLAGKHGDLTKTLYGRQVVFEPVKVLKTSTKL |
| Ga0207668_107112221 | 3300025972 | Switchgrass Rhizosphere | EGSHANLSVSIVLAGKHRDLPKTRHGRQVIFEPVKVMKTSTKL |
| Ga0207668_113198911 | 3300025972 | Switchgrass Rhizosphere | GSYALQEGTHTNLPVSIVLAGKHRDLTKTRPSRQVVFELIRVLKTLTKL |
| Ga0268347_10202022 | 3300028142 | Phyllosphere | ANLPVSIVLAGKHRDLTKTYHGRQMVFEPVRVMKTLTKL |
| Ga0268353_1148261 | 3300028149 | Phyllosphere | NLPISIVLAGKHGDLTKTRHGRQVVFEPVKVLKTSTKL |
| Ga0268341_10164061 | 3300028154 | Phyllosphere | NLPDIGSHALQEGSHANLLVGIVLAGKHRNLTKTRHGRRVVFEPVKVLKTSTEL |
| Ga0268309_10035811 | 3300028477 | Phyllosphere | VDIVLAGKHRDLPKTRHGRQVVFEPVKVLKTSTKL |
| Ga0268313_10113881 | 3300028523 | Phyllosphere | LSVGIILAGKHRDFTKTRHGRRVVFEPVKVLKTSTEL |
| Ga0061019_135154891 | 3300031118 | Fungi-Associated Bovine Rumen | EGSHANLSVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTEL |
| Ga0214491_11680191 | 3300032469 | Switchgrass Phyllosphere | LLLGSLAIIPVSIVLAGIHRDLTKTRHGRRVVLEQVKVLKTSTKL |
| Ga0214490_10805111 | 3300032502 | Switchgrass Phyllosphere | ISIVLAGKHWDLTKTCHGRQVVFELVKVLKTSTNL |
| Ga0214502_11013771 | 3300032514 | Switchgrass Phyllosphere | PVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTKL |
| Ga0214500_10297621 | 3300032589 | Switchgrass Phyllosphere | LPVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTKL |
| Ga0214484_10328131 | 3300032591 | Switchgrass Phyllosphere | PVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTEL |
| Ga0214497_10242981 | 3300032689 | Switchgrass Phyllosphere | SHALQEGSHTHLPISIILAGKHMDLTKTRHGRQVVFEPVKVLKTLTKL |
| Ga0214494_11071391 | 3300032699 | Switchgrass Phyllosphere | PSGKHHVSLVFGNIPDLGSHALQEDSHANFLVGIVLAGKYRDLPKTCHCRQVIFEQVWVMKTLTKL |
| Ga0314736_10344901 | 3300032843 | Switchgrass Phyllosphere | VGIVLAGKHRDLTMTRHGRQIIFEPVRVMKTLTNF |
| Ga0314727_10538891 | 3300032845 | Switchgrass Phyllosphere | PVDIILARKHGDLTKTRHGRRVVFEPVKVLKTSTEL |
| Ga0314749_10377981 | 3300032915 | Switchgrass Phyllosphere | PVGIILAGKHRDLTKTRHGRRVVFEPVKVLKTSTEL |
| Ga0314734_10503301 | 3300032916 | Switchgrass Phyllosphere | LPISIVLAEKHCDLTKTRHGRQVVFEPVKVLKTSTLL |
| Ga0314726_1059431 | 3300032918 | Switchgrass Phyllosphere | HALQEGSHANLPVGIVLAGKHRDLTKTRHGRRVVFEPVKVLKTSTKL |
| Ga0314738_10123472 | 3300032959 | Switchgrass Phyllosphere | VKLVRGNFPDIGSQALQEGSHANLLVGIVLTGKHRDLTKTRHDRRVVFEPVKVLKTSTEL |
| ⦗Top⦘ |