NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056279

Metagenome / Metatranscriptome Family F056279

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056279
Family Type Metagenome / Metatranscriptome
Number of Sequences 137
Average Sequence Length 51 residues
Representative Sequence VGEPEAGFLGTVTSGKLPKAKEKPTVASIWAVTLAEKTTPVLAAIELDV
Number of Associated Samples 85
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 29.20 %
% of genes near scaffold ends (potentially truncated) 38.69 %
% of genes from short scaffolds (< 2000 bps) 99.27 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (52.555 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(70.073 % of family members)
Environment Ontology (ENVO) Unclassified
(89.051 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(77.372 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 0.00%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF13456RVT_3 0.73



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.28 %
UnclassifiedrootN/A46.72 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005330|Ga0070690_101723398Not Available510Open in IMG/M
3300009092|Ga0105250_10287890All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300009177|Ga0105248_12468018All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300009972|Ga0105137_103586All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum699Open in IMG/M
3300009972|Ga0105137_108735Not Available542Open in IMG/M
3300009973|Ga0105136_113982Not Available505Open in IMG/M
3300009975|Ga0105129_101151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1110Open in IMG/M
3300009975|Ga0105129_109485All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum643Open in IMG/M
3300009975|Ga0105129_110423Not Available628Open in IMG/M
3300009976|Ga0105128_106515All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum725Open in IMG/M
3300009980|Ga0105135_103135All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum975Open in IMG/M
3300009980|Ga0105135_112002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum681Open in IMG/M
3300009989|Ga0105131_128816Not Available585Open in IMG/M
3300009990|Ga0105132_104859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum951Open in IMG/M
3300009990|Ga0105132_142809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum514Open in IMG/M
3300009992|Ga0105120_1021974Not Available710Open in IMG/M
3300009992|Ga0105120_1040592All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300009992|Ga0105120_1050128Not Available528Open in IMG/M
3300009994|Ga0105126_1005177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1093Open in IMG/M
3300009994|Ga0105126_1023222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum689Open in IMG/M
3300009995|Ga0105139_1004404All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1506Open in IMG/M
3300009995|Ga0105139_1010702Not Available1189Open in IMG/M
3300009995|Ga0105139_1046334Not Available754Open in IMG/M
3300009995|Ga0105139_1076835Not Available626Open in IMG/M
3300009995|Ga0105139_1107390Not Available539Open in IMG/M
3300010371|Ga0134125_12267035All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300010371|Ga0134125_12996484All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300010371|Ga0134125_13066041Not Available506Open in IMG/M
3300010397|Ga0134124_11626883All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum677Open in IMG/M
3300010399|Ga0134127_12529984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum593Open in IMG/M
3300010403|Ga0134123_12143341Not Available620Open in IMG/M
3300013306|Ga0163162_12154386Not Available640Open in IMG/M
3300014325|Ga0163163_12508176Not Available574Open in IMG/M
3300014968|Ga0157379_11488509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300014968|Ga0157379_11823764Not Available598Open in IMG/M
3300015270|Ga0182183_1072715Not Available550Open in IMG/M
3300015270|Ga0182183_1093674Not Available506Open in IMG/M
3300015278|Ga0182099_1053113All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum554Open in IMG/M
3300015280|Ga0182100_1046548All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum654Open in IMG/M
3300015280|Ga0182100_1099467Not Available500Open in IMG/M
3300015284|Ga0182101_1019444Not Available850Open in IMG/M
3300015290|Ga0182105_1008420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1114Open in IMG/M
3300015293|Ga0182103_1041059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum679Open in IMG/M
3300015297|Ga0182104_1072423All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300015301|Ga0182184_1091278Not Available521Open in IMG/M
3300015306|Ga0182180_1089631Not Available513Open in IMG/M
3300015309|Ga0182098_1086089All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum581Open in IMG/M
3300015310|Ga0182162_1108024Not Available539Open in IMG/M
3300015311|Ga0182182_1108046Not Available527Open in IMG/M
3300015313|Ga0182164_1054090Not Available713Open in IMG/M
3300015315|Ga0182120_1029682All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum879Open in IMG/M
3300015316|Ga0182121_1066280Not Available690Open in IMG/M
3300015319|Ga0182130_1089888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300015320|Ga0182165_1056421All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum726Open in IMG/M
3300015325|Ga0182148_1080903Not Available630Open in IMG/M
3300015326|Ga0182166_1075997All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum643Open in IMG/M
3300015326|Ga0182166_1143015Not Available506Open in IMG/M
3300015327|Ga0182114_1109180Not Available594Open in IMG/M
3300015327|Ga0182114_1162361Not Available500Open in IMG/M
3300015328|Ga0182153_1059413All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum718Open in IMG/M
3300015328|Ga0182153_1130736Not Available535Open in IMG/M
3300015330|Ga0182152_1062189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum716Open in IMG/M
3300015330|Ga0182152_1103459All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum592Open in IMG/M
3300015331|Ga0182131_1071838Not Available682Open in IMG/M
3300015331|Ga0182131_1126561Not Available548Open in IMG/M
3300015331|Ga0182131_1150013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum511Open in IMG/M
3300015333|Ga0182147_1020001All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1091Open in IMG/M
3300015333|Ga0182147_1091373All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015333|Ga0182147_1142942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum540Open in IMG/M
3300015334|Ga0182132_1077528All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum693Open in IMG/M
3300015334|Ga0182132_1145679Not Available536Open in IMG/M
3300015334|Ga0182132_1167091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300015336|Ga0182150_1024604All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1003Open in IMG/M
3300015337|Ga0182151_1080144Not Available672Open in IMG/M
3300015337|Ga0182151_1131708Not Available554Open in IMG/M
3300015337|Ga0182151_1151615All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300015338|Ga0182137_1120189All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum599Open in IMG/M
3300015339|Ga0182149_1141789Not Available548Open in IMG/M
3300015340|Ga0182133_1085330All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300015340|Ga0182133_1164250Not Available539Open in IMG/M
3300015340|Ga0182133_1174974All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300015348|Ga0182115_1095921Not Available928Open in IMG/M
3300015349|Ga0182185_1162902All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum667Open in IMG/M
3300015349|Ga0182185_1171231All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum651Open in IMG/M
3300015349|Ga0182185_1214608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum583Open in IMG/M
3300015350|Ga0182163_1064758All Organisms → Viruses → Predicted Viral1061Open in IMG/M
3300015350|Ga0182163_1143198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum741Open in IMG/M
3300015350|Ga0182163_1224666All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum588Open in IMG/M
3300015352|Ga0182169_1104959Not Available906Open in IMG/M
3300015352|Ga0182169_1147743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum766Open in IMG/M
3300015352|Ga0182169_1202599All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum648Open in IMG/M
3300015352|Ga0182169_1237995All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum593Open in IMG/M
3300015352|Ga0182169_1295570Not Available523Open in IMG/M
3300015353|Ga0182179_1068590Not Available1009Open in IMG/M
3300015353|Ga0182179_1091554Not Available898Open in IMG/M
3300015353|Ga0182179_1201008Not Available634Open in IMG/M
3300015353|Ga0182179_1259677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum561Open in IMG/M
3300015354|Ga0182167_1224578Not Available683Open in IMG/M
3300015354|Ga0182167_1224705Not Available682Open in IMG/M
3300017408|Ga0182197_1152946Not Available501Open in IMG/M
3300017412|Ga0182199_1101725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum661Open in IMG/M
3300017414|Ga0182195_1046637All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum908Open in IMG/M
3300017414|Ga0182195_1062776All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum819Open in IMG/M
3300017414|Ga0182195_1213221Not Available511Open in IMG/M
3300017421|Ga0182213_1149809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300017421|Ga0182213_1243848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300017422|Ga0182201_1013854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1077Open in IMG/M
3300017422|Ga0182201_1058938All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum685Open in IMG/M
3300017435|Ga0182194_1051371Not Available755Open in IMG/M
3300017445|Ga0182198_1070715All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum750Open in IMG/M
3300017691|Ga0182212_1135552Not Available559Open in IMG/M
3300017691|Ga0182212_1149907All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum531Open in IMG/M
3300017693|Ga0182216_1120242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
3300017694|Ga0182211_1109143Not Available650Open in IMG/M
3300020023|Ga0182178_1008393Not Available708Open in IMG/M
3300025910|Ga0207684_10329976Not Available1314Open in IMG/M
3300025925|Ga0207650_10820481All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum789Open in IMG/M
3300028055|Ga0268338_1037280Not Available534Open in IMG/M
3300028064|Ga0268340_1017568All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum866Open in IMG/M
3300028064|Ga0268340_1071235All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum541Open in IMG/M
3300028470|Ga0268307_1019552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300032466|Ga0214503_1201918All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum619Open in IMG/M
3300032467|Ga0214488_1007859Not Available1876Open in IMG/M
3300032467|Ga0214488_1101857All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum622Open in IMG/M
3300032468|Ga0214482_1090376Not Available582Open in IMG/M
3300032548|Ga0214483_1000030All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum5996Open in IMG/M
3300032590|Ga0214489_1045576Not Available657Open in IMG/M
3300032699|Ga0214494_1058267Not Available742Open in IMG/M
3300032699|Ga0214494_1106313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum521Open in IMG/M
3300032758|Ga0314746_1008976All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1861Open in IMG/M
3300032844|Ga0314743_1048248Not Available993Open in IMG/M
3300032914|Ga0314750_1010282Not Available1791Open in IMG/M
3300032914|Ga0314750_1100498Not Available674Open in IMG/M
3300032918|Ga0314726_124311Not Available678Open in IMG/M
3300032966|Ga0314722_1041423Not Available737Open in IMG/M
3300033532|Ga0314767_1199188Not Available503Open in IMG/M
3300033538|Ga0314755_1126644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum650Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere70.07%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated16.06%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.38%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere2.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.46%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.46%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.73%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.73%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009972Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009976Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028470Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032590Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032758Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032844Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032914Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032918Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032966Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033532Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033538Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070690_10172339813300005330Switchgrass RhizosphereIGSNPSEDAASGGGRAGSGKLPKVKEKPTVTSIWAVTLAEKTTPVLAAIELDV*
Ga0105250_1028789023300009092Switchgrass RhizosphereVGFLGTATSGKLPKVKEKPTVASIWAVMLAEKATLVLAAIELDV*
Ga0105248_1246801813300009177Switchgrass RhizosphereWGVRSDLTPAKTLPPTVEGPEAGFQGTVTSGKLPKVKEKPIGASICAVTLAEKTMPVLAAIELDV*
Ga0105137_10358613300009972Switchgrass AssociatedMVEGPEVGFLGTVTSGKLPKVKEKPTVASIWAVTLAEKTTPVLAAIELDI*
Ga0105137_10873513300009972Switchgrass AssociatedSGKLPKVKEKPTVTSIWVVKLAEKTTLVLAAIELDV*
Ga0105136_11398213300009973Switchgrass AssociatedLHPAAGEAEAGFLGTVTSGRLSKVKEKPTVASIWAVTLAEKTTPVLATIELDV*
Ga0105129_10115113300009975Switchgrass AssociatedAGFLGTVTSGKLPKVKEKPTVASIWAVTLAEKTMLVLAAIELDV*
Ga0105129_10948513300009975Switchgrass AssociatedVGEPEAGFLGTVTSGKLPKAKEKPTVASIWAVTLAEKTTPVLAAIELDV*
Ga0105129_11042313300009975Switchgrass AssociatedMTLPPAAGEPEAGFQGTVTSGKLPKAKEKPTVASILAVTLAEKTTPVLATIELDV*
Ga0105128_10651513300009976Switchgrass AssociatedVEGPEVRFLGTVTSGKSPKVKEKPTVASIWAVTLAEKMTPVLATIGLDV*
Ga0105135_10313513300009980Switchgrass AssociatedMTLPPAAGELEAGFLGTVTSGKLPKVKEKPTVASIWAVTLAEKTTLVLAAIELDV*
Ga0105135_11200213300009980Switchgrass AssociatedMVEGPEVGFLGTVVSGKLSKVKEKPTVASIWVVMLAEKTTPVLAAIELDI*
Ga0105131_12881613300009989Switchgrass AssociatedLPPAAGEPEVEFLGTVTSEKLPKVKEKPTVTSIWAVTLAEKTTPVLAAIELDV*
Ga0105132_10485913300009990Switchgrass AssociatedLEAEFLGTVTSGKLPKVKEKPTVASIWAVTLAEKTTPVLAAIELDV*
Ga0105132_14280913300009990Switchgrass AssociatedPTTMLPPVAGESEAGFLGIVTSGKLPKVKEKPTVTSIWAVTLAEKTTPVLAAIELDV*
Ga0105120_102197413300009992Switchgrass AssociatedLPPAAGEPEAGFLGIVTSGKLLKAKEKPTVASIWVVTLAEKMPVLAAIELNVEP*
Ga0105120_104059213300009992Switchgrass AssociatedMMLPTMVEGPEAGFLGIVTSGKLLKVKEKPTVTSIWAVTLAEKTMLVLAAIELDV*
Ga0105120_105012823300009992Switchgrass AssociatedLGTVTTGKLPKVKERPIVTSIWILTLAEKTTPVLASIELDV*
Ga0105126_100517713300009994Switchgrass AssociatedMEGPEVGFLGTVASGKLPKVKEKPTVTSIWAVTLEEKTMLVLAAIELDV*
Ga0105126_102322213300009994Switchgrass AssociatedMPGVRSNLTPAKTLPPAVGEPEAGFLGTVTSGKFPKVKEKPTVASIWAVTLAEKTTLVLAAIELDV*
Ga0105139_100440413300009995Switchgrass AssociatedSSKVEELDVGFLGTVTSGKFPKVKEKPTIASMWAMTLAEKTTPVLAAIELDV*
Ga0105139_101070213300009995Switchgrass AssociatedMVEGLEVGFMGSVASGNLPTVKEKPTVASIWVVTLAEKTTPVLAVVELDV*
Ga0105139_104633413300009995Switchgrass AssociatedMPPSKIEGLEVGFLGTVASRKLPKVKEKPTVTSTWAVMLAEKTTPVLSAIELDV*
Ga0105139_107683513300009995Switchgrass AssociatedLPPTVEGLEVGFLGTVASSKLSKVKEKLTVTSIWAVMLAEKMTPVLVAIELDV*
Ga0105139_110739013300009995Switchgrass AssociatedVGEAEAGFLGTVASGKLPKAKEKPTVASIWAVTLAEKTMLVLAAIELNV*
Ga0134125_1226703523300010371Terrestrial SoilVVEGPEAGFLGTVTSGKLPKVKEKPTVTSIWVVTLAEKTMLVLAAIELDV*
Ga0134125_1299648413300010371Terrestrial SoilLDLTPVTTLAPAVGEPEAGFLGTVTSGKLPNVKEKPTVASIWAVTQAEKTTPVLAAIELDL*
Ga0134125_1306604113300010371Terrestrial SoilVTSGKLPKVKEKPTVASIWVVTLAEKTTPVLAATELDV*
Ga0134124_1162688313300010397Terrestrial SoilVTSGKLPKVKEKLIVASIWTVTLTEKTTPVLAAIELDV*
Ga0134127_1252998413300010399Terrestrial SoilMFLIGVRSDLTLAKTLPPAVGEPEAGFLGTVTSGKLPRVKEKPTVASIWAVTLAEKTTPVFAAIELDL*
Ga0134123_1214334113300010403Terrestrial SoilVTSGKLPKVKEKPTVAFIWAVTQAEKTTPVLAAIELNV*
Ga0163162_1215438613300013306Switchgrass RhizosphereGTVTSGKLPKVKVKPIVASIWAVTLAEKTTSVLAAIELDV*
Ga0163163_1250817613300014325Switchgrass RhizosphereLTSAKTLPPAMGEPEAGFLGTVTSEKLPKVKKKPTVATIWAVTLAEKTMPVLAAIELDV*
Ga0157379_1148850913300014968Switchgrass RhizospherePTVEGPEAGFLGIVTSGKLPKVKEKPTVTSIWAATLTEKMTPALAAIELDM*
Ga0157379_1182376413300014968Switchgrass RhizosphereLPPAAGEPEAGFLGTVTSGELPKVKEKPIVASIWAVTLTEKMTPLLAAIELDV*
Ga0182183_107271513300015270Switchgrass PhyllosphereLPPAAGEPEAGFLGTVTSGKHPKVKEKLNAASIWAVTRAEKTTPVLAAIELNL*
Ga0182183_109367413300015270Switchgrass PhyllosphereMTSGKLSKVKEKPIVASIWAVTLAEKTTPVLAAIELD
Ga0182099_105311313300015278Switchgrass PhyllosphereVTSGKLPKVKEKPTVASIYAVTLAEKTTLVLAAIELDV*
Ga0182100_104654813300015280Switchgrass PhyllosphereVGEPEAGFLGTVTSGKLLKVKEKPAVASIWAVTLTEKTTPVLAAIELDV*
Ga0182100_109946713300015280Switchgrass PhyllosphereMLHSKVEELDVGFLCTVTFGKLPKVKEKPMVASIWMVTLAEKMTPVLAAIELDV*
Ga0182101_101944423300015284Switchgrass PhyllosphereMGVEEIRSDLTPVKVLPSKVEGLDVGFLGTLISKKLPKVKEKPTVASIWAVKLAEKTTPVLAAIELDI*
Ga0182105_100842023300015290Switchgrass PhyllosphereVTVLLSKVEKPDVGFLGTVTSGKLPKVKEKPTITFIEMLTLAEKTMPVLAAI*
Ga0182103_104105923300015293Switchgrass PhyllosphereMLPPVAGESESGFLGTVTSGKLLKVKEKPTVASIWVVTLVEKTMPVLAAIELDV*
Ga0182104_107242323300015297Switchgrass PhyllosphereVASGKLPKVKEKPTVASIWAVTLAEKTTLVLAAIELDV*
Ga0182184_109127813300015301Switchgrass PhyllosphereLPPAVEGPEVGFLGTVTFGKLPKAKEKPTITSIWAVTLAEKTTPVLATIELDV*
Ga0182180_108963113300015306Switchgrass PhyllosphereLDLTPATTLPPAVGEPEAGFLGTVTSGKLPKAKEKPTVASIWAVTLAEKTTLVLAAIELDI*
Ga0182098_108608913300015309Switchgrass PhyllospherePAKTLPPAVGEPEAGFLGTVTSGKLPKAKEKPTVASIWAVTLVEKTMPVLAAIELDV*
Ga0182162_110802413300015310Switchgrass PhyllospherePPAVGEPEAGFLGTVTSGKPPKVKEKPTVASIWAAIELDV*
Ga0182182_110804623300015311Switchgrass PhyllosphereMVEVLEVGFLGTVTSRKLPKVKEKPTVASIWAVTLAKKTAPVLAAIELDV*
Ga0182164_105409013300015313Switchgrass PhyllosphereMLSSKVEELDVGFLGTVTSGKFPKVKEKPTVASMWAMTLAEKTTPVLAAIELDV*
Ga0182120_102968213300015315Switchgrass PhyllosphereMTLPPAAGEPEAGFQGTVTSGKLPKVKEKPTVASIWAVMLAEKTMLVLAAIELNV*
Ga0182121_106628013300015316Switchgrass PhyllosphereSDKLPKVKVKPIVASIWAVTLAEKMTPVLAAIELDV*
Ga0182130_108988813300015319Switchgrass PhyllosphereLPPAVEGPEVGFLGTVTSGKLPKVKEKPTVTSIWAVMLAEKTTPVLAAIELDV*
Ga0182165_105642113300015320Switchgrass PhyllosphereEAGFLGTVTSGKLPKVKEKPTVASIWAVTLAEKTTPVLAAIELDV*
Ga0182148_108090313300015325Switchgrass PhyllosphereMTSGKLSKVKEKPIVASIWAVTLAEKTTPVLAAIELDV*
Ga0182166_107599723300015326Switchgrass PhyllosphereLPPTVEGPEAGFLGTVTSGKLPKVNEKPTVTSIWAVMLVEKTTPVLAAIELDV*
Ga0182166_114301513300015326Switchgrass PhyllosphereLGTVTSGKLPKVKEKLTVASIWAVTLAEKMTPVLAAIELDV*
Ga0182114_110918013300015327Switchgrass PhyllosphereLPPAVEGPEVGFLGTVTSGKLPKMKEKLTVASIWAVTLVEKTTLVLAAIELDV*
Ga0182114_116236113300015327Switchgrass PhyllosphereLPPAARELEAGFLGTVTSESLPKVKEKPTVASIWALTLAEKMTPVLATIELDI*
Ga0182153_105941323300015328Switchgrass PhyllosphereLPPAAGEPEAGFLGTVTSGKLPKVKEKPTVASIWAVMLAEKTMLVLAAIELNV*
Ga0182153_113073613300015328Switchgrass PhyllosphereVGEAEAGFLGTVTSGKLPKAKEKPTVASIWAVTLAEKTTLVLAAIELDV*
Ga0182152_106218913300015330Switchgrass PhyllosphereLVGEPEAGFLGTVTSGKLPKVKQKPTVASIWAVTLTEKTMLVLAAIELDV*
Ga0182152_110345913300015330Switchgrass PhyllosphereLPPAAGKPETGFLGTVTSGKLPKVKEKPTVASIWVVMLAEKTTPVLAAIELDV*
Ga0182131_107183813300015331Switchgrass PhyllosphereGKLPTAKEKPIIASIWAVTLAEKMTPMLAAIELDV*
Ga0182131_112656123300015331Switchgrass PhyllosphereVTSGKLPEVKEKPIVASIWAVTLAEKTTPALAAIELDV*
Ga0182131_115001313300015331Switchgrass PhyllosphereTLAKTLPPAVEGPAAGFLGTVTSGKLPKVKEKPTIAFIWAVTLAEKTTLVLAAIELDV*
Ga0182147_102000123300015333Switchgrass PhyllosphereMEGPEVGFLGTVASGKLPKVKEKPTVTSIWAVTLAEKTTPVLAAIELDV*
Ga0182147_109137323300015333Switchgrass PhyllosphereVKTLPSAVGEPEAGFLGTVISGKLPKVKKKPTVASIWAVTLAEKTTLVLATIELDV*
Ga0182147_114294213300015333Switchgrass PhyllosphereLDLATAKTLPPAVGEPEAGFLGTVTSGKLPKAKEKPTVASIWAVTLMEKTMPVLAAIELDI*
Ga0182132_107752813300015334Switchgrass PhyllosphereVGEPEAGFLGTVTSGKFPKVKEKPTVASIWVVTLAEKTTLVLAAIELDV*
Ga0182132_114567913300015334Switchgrass PhyllosphereLTVLLSKVEELDVGFLGTVTFGKLPKVKVKLTVASIWMLTLAEKTTPVLAAIKHNV*
Ga0182132_116709113300015334Switchgrass PhyllosphereAVGEPEAGFLGTVTSGKLAKVKEKPTVTSIWAVTLAEKTTPVLAAIELDV*
Ga0182150_102460413300015336Switchgrass PhyllosphereMKMLPPTVEGPEAGFLGTVTSGKLPKVKEKPIVASIWGVMLAEKTTTVLAAIELDV*
Ga0182151_108014423300015337Switchgrass PhyllosphereLTVLLSKVEELDVGFLGTVTFGKLPKVKVKLTVASIWMLTLAEQTTPVLAAIKHNV*
Ga0182151_113170813300015337Switchgrass PhyllosphereMLPSKVEELAIGFLGTMAFGKLPMVKEKPTVASIYAVTLAEKTTLVLAAIELDV*
Ga0182151_115161513300015337Switchgrass PhyllosphereMVKGPEVGFLGTVASGKLLKVKEKPTVASIWAVTLAEKTTS
Ga0182137_112018913300015338Switchgrass PhyllosphereMKMLPPMVEGPEAGFLGTVTSGKLPKVKEKPIIASIWAVTLAEKTMPVLAATELDV*
Ga0182149_114178913300015339Switchgrass PhyllosphereGEPEAVFLGTVTSGKLSKAKEKTIVASIWAVTLAEKTTPVFAAIELDV*
Ga0182133_108533013300015340Switchgrass PhyllosphereMVKGPEVGFLGTVASGKLPKVKEKPTVTSIWAVTLAEKTTSVLATIELNV*
Ga0182133_116425013300015340Switchgrass PhyllosphereMKTLPPAMGEPEAGFLGTMTSGKLPKVKTSGKLPKVKEKSTVASIWAVTLAEKTTPVLAAIELDVCNTLT*
Ga0182133_117497423300015340Switchgrass PhyllosphereVAGRPEAGFLGIVTSGKLPKAKEKPTVASIWAVMLAEKTTPVLAAIELDV*
Ga0182115_109592133300015348Switchgrass PhyllosphereMGSNPSEDVAPEVGFLGTVTSGKFPKVKENLTVASIWAVTLAEKTTPVLAAIELDV*
Ga0182185_116290213300015349Switchgrass PhyllosphereMKTLPPAVGKPEVGFLGTVTSGKLPKAKEKPTVASILVVTLAQKTAPVLAAIELDV
Ga0182185_117123113300015349Switchgrass PhyllosphereLPPAAGEPEAGFLGTVTSGKLPNVKEKPIVASIWAVMLAEKMTPVLVAIELDV*
Ga0182185_121460813300015349Switchgrass PhyllosphereVTSGKLPNVKEKTTVASIWVVTLPEKTTLVLAAIELDV*
Ga0182163_106475813300015350Switchgrass PhyllosphereVGEAEAGFLGTVTSRKLPKAKEKPTVASIWAVTLAEKTMPVLAAIELDI*
Ga0182163_114319813300015350Switchgrass PhyllosphereMLPPTVEGPEAGFLGTVTSGKLPKVKEKPIVASIWGVMLAEKTMPV
Ga0182163_122466613300015350Switchgrass PhyllosphereDLTPAKTLPPAAWEPEAGFLGTVTSGKLPKVKEKLTITSIWVVMLAEKTSPVLATIELDI
Ga0182169_110495923300015352Switchgrass PhyllosphereMTSGKLSKVKEKPIVASIWAMTLAEKTTPVLAAIELDV*
Ga0182169_114774313300015352Switchgrass PhyllosphereMVEGPEAGFLGTVTSGKLPKVKEKPIVASIWAVTLAEKTMPVLAATELDV*
Ga0182169_120259923300015352Switchgrass PhyllosphereLPPAVEGPDVGFLGTVTSGKLPKVKEKPTIAFIWAVTLAEKTMPVLASIE
Ga0182169_123799513300015352Switchgrass PhyllosphereLDLTPVTTLPPAAGEPEARFLGTVTSGKLPKVKKKPTAASFWAVTLAEKTTPVLAAIELD
Ga0182169_129557013300015352Switchgrass PhyllosphereVGFLGTVASEKLPKVNEKPTVTFIWAVTLAEKTTLVLAAIELDV*
Ga0182179_106859023300015353Switchgrass PhyllosphereVTSGKLPEVKEKPTVTSIWAVTLAEKTTPVLAAIELDV*
Ga0182179_109155433300015353Switchgrass PhyllosphereMLHSKVEELDVGFLCTVTFGKLPKVKEKPMVAFIWMVTLAEKMTPV
Ga0182179_120100813300015353Switchgrass PhyllosphereMVKEPEAGFLVTIASGKLPKAKEKPTVASIWAVTLAEKTMPVLAAIELDV*
Ga0182179_125967713300015353Switchgrass PhyllosphereLPPGVEGPEVGFLGTVTSGKLPKVKEKPTVTSIWAVTLAEKTTPVLAAIELDV*
Ga0182167_122457823300015354Switchgrass PhyllosphereVGFLGTVTSRKLPKVKEKPTVASIWTVMLAEKTMPVLAAIELDI*
Ga0182167_122470513300015354Switchgrass PhyllosphereLPPTVEGPEAGFLGTVTSGKLLKVKEKPIIASIWAVTLAEKTMPVLAATELDV*
Ga0182197_115294613300017408Switchgrass PhyllosphereGPEVGFLGTVASEKLPKVNEKPTVAFIWAVTLAEKTTLVLAAIELDV
Ga0182199_110172513300017412Switchgrass PhyllosphereVKTLPSAVGEPEAGFLGTVISGKLPKVKEKPTVASIWAVTLAEKTTPVLAAIELDV
Ga0182195_104663713300017414Switchgrass PhyllosphereVRALPSKVEGPEVGFLGTVASGKLPKVKEKLTVTSIWVVTLTEKTTPVLAAIELDV
Ga0182195_106277613300017414Switchgrass PhyllosphereDLTPAKTLPPAAGEPEAGFLGIVTSGKLPKVKEKPTVTSIWAVTLAEKTTPVLAAIELDV
Ga0182195_121322123300017414Switchgrass PhyllosphereVGFLGTVTFGKLPKAKEKPTITSIWAVTLAEKTTPVLAAIE
Ga0182213_114980913300017421Switchgrass PhyllosphereVLGGVRSDLTPAKTLPPVVEAGFLGTVTSGKLPKVKEKLIVASIWAVTLAKKTMPVLAAIELDV
Ga0182213_124384813300017421Switchgrass PhyllospherePVKTLPLAVGEPEVGFLGTVTSGKLPKAKEKPTVASIWAVMLAEKTMPVLAANELDI
Ga0182201_101385423300017422Switchgrass PhyllosphereVFGGVRSDLTPTKTLPPAVGEPEAGFLGTVISGKLPKVKEKPTIASIWVVTLTEKTTPVLAAIELNV
Ga0182201_105893823300017422Switchgrass PhyllosphereLGVRSDLTQAAILPPAVGEPEAGFLGTVTSGKLPKVKKKPTVASIWAVTLAEKTTLVLATIELDV
Ga0182194_105137113300017435Switchgrass PhyllosphereLPPVVGELEAGFLRTVTSGKLRKAKEKPTVASIWAVTLVEKMTPVLAAIELDV
Ga0182198_107071513300017445Switchgrass PhyllosphereAVGEPEAGFLGTVTSGKLPKAKEKPTVASIWAVTLMEKTMPVLAAIELDI
Ga0182212_113555213300017691Switchgrass PhyllosphereLDLTIGTSWPPAARGPEAGFLGTMTFGKLPKVKEKPIVASIWAMTLAEKTTPVLAAIELN
Ga0182212_114990713300017691Switchgrass PhyllosphereLDLTPAKTLHPAVEGPKAGFLGTVTSGKLPKVKEKPTVASIWAVTLAEKTTPVLAAIELD
Ga0182216_112024213300017693Switchgrass PhyllosphereMLPPAVGEPEAGFLGTVTSGKFPKVKEKPTVASIWAVTLAEKTTLVLAAIELDV
Ga0182211_110914313300017694Switchgrass PhyllosphereSDLTSAKTLPPAAGEPEAGFLGTVTTVKLPKAKEKPTVASIWAEMLAEKTTPVLAAIELD
Ga0182178_100839313300020023Switchgrass PhyllospherePPAAGEPEAGFLGIVTSWKLPKAKEKSTVTSIWAVTLAEKTTPVLAAIELDV
Ga0207684_1032997623300025910Corn, Switchgrass And Miscanthus RhizosphereVKTLPPMVEGTRVGFLGTVAFGKLPKVKEKPTVTSIWAVMLAEKTTPVLAAIELDV
Ga0207650_1082048113300025925Switchgrass RhizosphereTPAKTLPPAVEGPDVGFLGTVTSGKLPKVKEMPTVASIWTVTLAEKTTPVLAAIELDV
Ga0268338_103728013300028055PhyllosphereKAGFQGIVTSGKLSKVKEKPTIASIWAVTLAEKTTPVLAAIELDV
Ga0268340_101756823300028064PhyllosphereWGFLGTVASGKLPKVKEKPTVASIWAVTLAEKTTPVLAAIELDV
Ga0268340_107123513300028064PhyllosphereVGGQIGSSPVKTLPPTMEGPEVGFLGTVASGKLPKVKEKPTVTSIWAVTLAEKTTLMLAAIELDI
Ga0268307_101955213300028470PhyllosphereRSDLTPAKTLPPAVEGPDVGFLGTVTSGKLPKVKEMPTVASIWTVTLAEKTTPVLAAIELDV
Ga0214503_120191813300032466Switchgrass PhyllosphereVEGPEAGFQGTVTSGKLPKVKEKPIGASICAVTLAEKTMPVLAAIELDI
Ga0214488_100785913300032467Switchgrass PhyllosphereSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELDV
Ga0214488_110185713300032467Switchgrass PhyllospherePAAGEPEAGFLGIVTSGKLPKVKEKPTVASIWAVTPAEKTTPVLAAIELDV
Ga0214482_109037613300032468Switchgrass PhyllosphereMGFLGSVTFGKLPKVKEKPTVASIWAMTLAEKTMPMLVA
Ga0214483_100003013300032548Switchgrass PhyllosphereMLPSKVEELAMGFLGSVTFGKLPKVKEKPTVASIWAMTLAEKTMPMLVAIELDV
Ga0214489_104557613300032590Switchgrass PhyllosphereGTVTSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELNV
Ga0214494_105826713300032699Switchgrass PhyllosphereVKMLPSKVEELVIGFLGTMTSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELDV
Ga0214494_110631313300032699Switchgrass PhyllosphereLPPAAGELEAGFLGTVTSGKLPKVKEKPTVASIWAVTLVKKTTLVLAAIELD
Ga0314746_100897613300032758Switchgrass PhyllosphereGFLGTVTSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELDV
Ga0314743_104824813300032844Switchgrass PhyllosphereTSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELDV
Ga0314750_101028213300032914Switchgrass PhyllosphereVKTLPSVVEGLEVGFLGTVASGKLLKVKEKPNVTSIWAVTLVLPAIELNV
Ga0314750_110049813300032914Switchgrass PhyllosphereMTSGKLPKVKEKPTVASIWAMMLADKTTPVLVAIELDV
Ga0314726_12431113300032918Switchgrass PhyllosphereMTSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELDV
Ga0314722_104142313300032966Switchgrass PhyllosphereMLPSKVEELVIGFLGTMTSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELDV
Ga0314767_119918813300033532Switchgrass PhyllosphereLPSKVEELVIGFLGTMTSGKLPKVKEKPTVASIWAMMLAEKTTPVLVAIELDV
Ga0314755_112664413300033538Switchgrass PhyllosphereMLPPVAGESEAGFLGTVTSGKLPKVKEKPTVASIWAVTLVEMTTLMLAAIELNV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.