| Basic Information | |
|---|---|
| Family ID | F019940 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 226 |
| Average Sequence Length | 40 residues |
| Representative Sequence | FMYDGRDKNTNSQTNSSTKHILNTYGGVMQNEIYCN |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 226 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.46 % |
| % of genes near scaffold ends (potentially truncated) | 82.74 % |
| % of genes from short scaffolds (< 2000 bps) | 96.02 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.186 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (83.186 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.575 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (74.336 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.88% β-sheet: 0.00% Coil/Unstructured: 53.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 226 Family Scaffolds |
|---|---|---|
| PF00931 | NB-ARC | 1.77 |
| PF00450 | Peptidase_S10 | 0.44 |
| PF13966 | zf-RVT | 0.44 |
| PF13540 | RCC1_2 | 0.44 |
| PF02896 | PEP-utilizers_C | 0.44 |
| PF03107 | C1_2 | 0.44 |
| PF00067 | p450 | 0.44 |
| COG ID | Name | Functional Category | % Frequency in 226 Family Scaffolds |
|---|---|---|---|
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.44 |
| COG2939 | Carboxypeptidase C (cathepsin A) | Amino acid transport and metabolism [E] | 0.44 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.19 % |
| All Organisms | root | All Organisms | 16.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005719|Ga0068861_102084983 | Not Available | 567 | Open in IMG/M |
| 3300005842|Ga0068858_102341495 | Not Available | 528 | Open in IMG/M |
| 3300005843|Ga0068860_102606788 | Not Available | 525 | Open in IMG/M |
| 3300009101|Ga0105247_11826746 | Not Available | 506 | Open in IMG/M |
| 3300009981|Ga0105133_114429 | Not Available | 642 | Open in IMG/M |
| 3300009990|Ga0105132_112427 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 744 | Open in IMG/M |
| 3300010373|Ga0134128_12810266 | Not Available | 536 | Open in IMG/M |
| 3300010399|Ga0134127_13549780 | Not Available | 511 | Open in IMG/M |
| 3300010403|Ga0134123_13165002 | Not Available | 529 | Open in IMG/M |
| 3300014325|Ga0163163_12985092 | Not Available | 528 | Open in IMG/M |
| 3300014968|Ga0157379_12132650 | Not Available | 556 | Open in IMG/M |
| 3300015270|Ga0182183_1047572 | Not Available | 628 | Open in IMG/M |
| 3300015278|Ga0182099_1052242 | Not Available | 557 | Open in IMG/M |
| 3300015280|Ga0182100_1055288 | Not Available | 618 | Open in IMG/M |
| 3300015284|Ga0182101_1026945 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 773 | Open in IMG/M |
| 3300015284|Ga0182101_1065874 | Not Available | 583 | Open in IMG/M |
| 3300015290|Ga0182105_1054130 | Not Available | 642 | Open in IMG/M |
| 3300015293|Ga0182103_1044710 | Not Available | 662 | Open in IMG/M |
| 3300015293|Ga0182103_1089510 | Not Available | 530 | Open in IMG/M |
| 3300015297|Ga0182104_1032160 | Not Available | 789 | Open in IMG/M |
| 3300015297|Ga0182104_1033254 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 781 | Open in IMG/M |
| 3300015297|Ga0182104_1082664 | Not Available | 578 | Open in IMG/M |
| 3300015301|Ga0182184_1058295 | Not Available | 608 | Open in IMG/M |
| 3300015301|Ga0182184_1062513 | Not Available | 594 | Open in IMG/M |
| 3300015306|Ga0182180_1087079 | Not Available | 519 | Open in IMG/M |
| 3300015309|Ga0182098_1069118 | Not Available | 626 | Open in IMG/M |
| 3300015309|Ga0182098_1099367 | Not Available | 552 | Open in IMG/M |
| 3300015309|Ga0182098_1105408 | Not Available | 540 | Open in IMG/M |
| 3300015309|Ga0182098_1125012 | Not Available | 507 | Open in IMG/M |
| 3300015310|Ga0182162_1044804 | Not Available | 737 | Open in IMG/M |
| 3300015310|Ga0182162_1051189 | Not Available | 705 | Open in IMG/M |
| 3300015310|Ga0182162_1112424 | Not Available | 531 | Open in IMG/M |
| 3300015311|Ga0182182_1078408 | Not Available | 592 | Open in IMG/M |
| 3300015312|Ga0182168_1016388 | Not Available | 1043 | Open in IMG/M |
| 3300015312|Ga0182168_1044063 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 766 | Open in IMG/M |
| 3300015312|Ga0182168_1093970 | Not Available | 584 | Open in IMG/M |
| 3300015312|Ga0182168_1129557 | Not Available | 514 | Open in IMG/M |
| 3300015312|Ga0182168_1131597 | Not Available | 511 | Open in IMG/M |
| 3300015313|Ga0182164_1054840 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 709 | Open in IMG/M |
| 3300015313|Ga0182164_1095497 | Not Available | 580 | Open in IMG/M |
| 3300015313|Ga0182164_1100583 | Not Available | 569 | Open in IMG/M |
| 3300015313|Ga0182164_1104106 | Not Available | 561 | Open in IMG/M |
| 3300015313|Ga0182164_1135263 | Not Available | 505 | Open in IMG/M |
| 3300015315|Ga0182120_1038735 | Not Available | 805 | Open in IMG/M |
| 3300015316|Ga0182121_1080271 | Not Available | 642 | Open in IMG/M |
| 3300015317|Ga0182136_1035390 | Not Available | 829 | Open in IMG/M |
| 3300015317|Ga0182136_1080057 | Not Available | 626 | Open in IMG/M |
| 3300015318|Ga0182181_1026186 | Not Available | 829 | Open in IMG/M |
| 3300015318|Ga0182181_1048970 | Not Available | 676 | Open in IMG/M |
| 3300015318|Ga0182181_1083329 | Not Available | 565 | Open in IMG/M |
| 3300015320|Ga0182165_1143567 | Not Available | 508 | Open in IMG/M |
| 3300015325|Ga0182148_1009744 | Not Available | 1220 | Open in IMG/M |
| 3300015325|Ga0182148_1119019 | Not Available | 545 | Open in IMG/M |
| 3300015326|Ga0182166_1015599 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1056 | Open in IMG/M |
| 3300015326|Ga0182166_1038808 | Not Available | 806 | Open in IMG/M |
| 3300015327|Ga0182114_1135206 | Not Available | 543 | Open in IMG/M |
| 3300015327|Ga0182114_1138733 | Not Available | 537 | Open in IMG/M |
| 3300015327|Ga0182114_1149505 | Not Available | 520 | Open in IMG/M |
| 3300015328|Ga0182153_1014201 | Not Available | 1126 | Open in IMG/M |
| 3300015328|Ga0182153_1077550 | Not Available | 654 | Open in IMG/M |
| 3300015328|Ga0182153_1132610 | Not Available | 533 | Open in IMG/M |
| 3300015328|Ga0182153_1138518 | Not Available | 524 | Open in IMG/M |
| 3300015329|Ga0182135_1019896 | Not Available | 1035 | Open in IMG/M |
| 3300015329|Ga0182135_1047865 | Not Available | 782 | Open in IMG/M |
| 3300015329|Ga0182135_1114950 | Not Available | 568 | Open in IMG/M |
| 3300015329|Ga0182135_1125955 | Not Available | 547 | Open in IMG/M |
| 3300015329|Ga0182135_1126525 | Not Available | 546 | Open in IMG/M |
| 3300015330|Ga0182152_1074294 | Not Available | 671 | Open in IMG/M |
| 3300015331|Ga0182131_1062001 | Not Available | 719 | Open in IMG/M |
| 3300015332|Ga0182117_1121866 | Not Available | 581 | Open in IMG/M |
| 3300015332|Ga0182117_1148876 | Not Available | 532 | Open in IMG/M |
| 3300015333|Ga0182147_1016914 | Not Available | 1148 | Open in IMG/M |
| 3300015334|Ga0182132_1084832 | Not Available | 669 | Open in IMG/M |
| 3300015335|Ga0182116_1055632 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 813 | Open in IMG/M |
| 3300015335|Ga0182116_1105821 | Not Available | 633 | Open in IMG/M |
| 3300015335|Ga0182116_1167759 | Not Available | 518 | Open in IMG/M |
| 3300015336|Ga0182150_1061846 | Not Available | 738 | Open in IMG/M |
| 3300015337|Ga0182151_1001279 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 2238 | Open in IMG/M |
| 3300015337|Ga0182151_1008853 | Not Available | 1347 | Open in IMG/M |
| 3300015337|Ga0182151_1088955 | Not Available | 646 | Open in IMG/M |
| 3300015339|Ga0182149_1013929 | Not Available | 1238 | Open in IMG/M |
| 3300015339|Ga0182149_1063660 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 752 | Open in IMG/M |
| 3300015339|Ga0182149_1104737 | Not Available | 622 | Open in IMG/M |
| 3300015340|Ga0182133_1119057 | Not Available | 619 | Open in IMG/M |
| 3300015340|Ga0182133_1140196 | Not Available | 578 | Open in IMG/M |
| 3300015348|Ga0182115_1061125 | Not Available | 1126 | Open in IMG/M |
| 3300015348|Ga0182115_1152321 | Not Available | 740 | Open in IMG/M |
| 3300015348|Ga0182115_1156414 | Not Available | 730 | Open in IMG/M |
| 3300015348|Ga0182115_1167570 | Not Available | 704 | Open in IMG/M |
| 3300015348|Ga0182115_1203742 | Not Available | 634 | Open in IMG/M |
| 3300015348|Ga0182115_1286083 | Not Available | 521 | Open in IMG/M |
| 3300015349|Ga0182185_1063329 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1002 | Open in IMG/M |
| 3300015349|Ga0182185_1130324 | Not Available | 740 | Open in IMG/M |
| 3300015349|Ga0182185_1176615 | Not Available | 642 | Open in IMG/M |
| 3300015349|Ga0182185_1248756 | Not Available | 541 | Open in IMG/M |
| 3300015350|Ga0182163_1059482 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 1098 | Open in IMG/M |
| 3300015350|Ga0182163_1068607 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 1036 | Open in IMG/M |
| 3300015350|Ga0182163_1100131 | Not Available | 878 | Open in IMG/M |
| 3300015350|Ga0182163_1148928 | Not Available | 727 | Open in IMG/M |
| 3300015350|Ga0182163_1174242 | Not Available | 672 | Open in IMG/M |
| 3300015350|Ga0182163_1286903 | Not Available | 515 | Open in IMG/M |
| 3300015352|Ga0182169_1013936 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1962 | Open in IMG/M |
| 3300015352|Ga0182169_1038706 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1382 | Open in IMG/M |
| 3300015352|Ga0182169_1068826 | Not Available | 1097 | Open in IMG/M |
| 3300015352|Ga0182169_1120740 | Not Available | 847 | Open in IMG/M |
| 3300015352|Ga0182169_1152674 | Not Available | 754 | Open in IMG/M |
| 3300015352|Ga0182169_1195570 | Not Available | 661 | Open in IMG/M |
| 3300015352|Ga0182169_1218720 | Not Available | 622 | Open in IMG/M |
| 3300015352|Ga0182169_1228412 | Not Available | 607 | Open in IMG/M |
| 3300015352|Ga0182169_1240882 | Not Available | 589 | Open in IMG/M |
| 3300015353|Ga0182179_1012259 | Not Available | 1825 | Open in IMG/M |
| 3300015353|Ga0182179_1050844 | Not Available | 1131 | Open in IMG/M |
| 3300015353|Ga0182179_1075454 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 971 | Open in IMG/M |
| 3300015353|Ga0182179_1146651 | Not Available | 734 | Open in IMG/M |
| 3300015353|Ga0182179_1189606 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 652 | Open in IMG/M |
| 3300015353|Ga0182179_1246434 | Not Available | 576 | Open in IMG/M |
| 3300015354|Ga0182167_1000793 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 4394 | Open in IMG/M |
| 3300015354|Ga0182167_1036897 | Not Available | 1608 | Open in IMG/M |
| 3300015354|Ga0182167_1043158 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Dichantheliinae → Dichanthelium → Dichanthelium oligosanthes | 1515 | Open in IMG/M |
| 3300015354|Ga0182167_1044379 | Not Available | 1500 | Open in IMG/M |
| 3300015354|Ga0182167_1134662 | Not Available | 912 | Open in IMG/M |
| 3300015354|Ga0182167_1172174 | Not Available | 797 | Open in IMG/M |
| 3300015354|Ga0182167_1340577 | Not Available | 526 | Open in IMG/M |
| 3300017412|Ga0182199_1075315 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae | 738 | Open in IMG/M |
| 3300017412|Ga0182199_1144080 | Not Available | 578 | Open in IMG/M |
| 3300017414|Ga0182195_1117736 | Not Available | 649 | Open in IMG/M |
| 3300017414|Ga0182195_1150457 | Not Available | 590 | Open in IMG/M |
| 3300017414|Ga0182195_1214659 | Not Available | 509 | Open in IMG/M |
| 3300017421|Ga0182213_1194318 | Not Available | 577 | Open in IMG/M |
| 3300017422|Ga0182201_1079472 | Not Available | 620 | Open in IMG/M |
| 3300017432|Ga0182196_1037808 | Not Available | 815 | Open in IMG/M |
| 3300017432|Ga0182196_1060142 | Not Available | 700 | Open in IMG/M |
| 3300017432|Ga0182196_1133537 | Not Available | 532 | Open in IMG/M |
| 3300017439|Ga0182200_1091655 | Not Available | 618 | Open in IMG/M |
| 3300017439|Ga0182200_1104433 | Not Available | 591 | Open in IMG/M |
| 3300017440|Ga0182214_1090570 | Not Available | 645 | Open in IMG/M |
| 3300017440|Ga0182214_1127715 | Not Available | 555 | Open in IMG/M |
| 3300017440|Ga0182214_1137837 | Not Available | 537 | Open in IMG/M |
| 3300017445|Ga0182198_1065439 | Not Available | 772 | Open in IMG/M |
| 3300017445|Ga0182198_1177628 | Not Available | 530 | Open in IMG/M |
| 3300017693|Ga0182216_1080971 | Not Available | 751 | Open in IMG/M |
| 3300017693|Ga0182216_1098675 | Not Available | 697 | Open in IMG/M |
| 3300017693|Ga0182216_1137939 | Not Available | 611 | Open in IMG/M |
| 3300017693|Ga0182216_1138581 | Not Available | 610 | Open in IMG/M |
| 3300017693|Ga0182216_1224518 | Not Available | 502 | Open in IMG/M |
| 3300028050|Ga0268328_1019398 | Not Available | 790 | Open in IMG/M |
| 3300028050|Ga0268328_1020832 | Not Available | 773 | Open in IMG/M |
| 3300028050|Ga0268328_1021101 | Not Available | 769 | Open in IMG/M |
| 3300028050|Ga0268328_1072791 | Not Available | 500 | Open in IMG/M |
| 3300028053|Ga0268346_1044527 | Not Available | 503 | Open in IMG/M |
| 3300028055|Ga0268338_1024202 | Not Available | 613 | Open in IMG/M |
| 3300028055|Ga0268338_1038566 | Not Available | 528 | Open in IMG/M |
| 3300028056|Ga0268330_1061687 | Not Available | 506 | Open in IMG/M |
| 3300028058|Ga0268332_1060886 | Not Available | 556 | Open in IMG/M |
| 3300028058|Ga0268332_1069687 | Not Available | 528 | Open in IMG/M |
| 3300028061|Ga0268314_1031284 | Not Available | 613 | Open in IMG/M |
| 3300028064|Ga0268340_1058427 | Not Available | 583 | Open in IMG/M |
| 3300028139|Ga0268355_1014368 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 549 | Open in IMG/M |
| 3300028140|Ga0268334_1014758 | Not Available | 551 | Open in IMG/M |
| 3300028141|Ga0268326_1008544 | Not Available | 586 | Open in IMG/M |
| 3300028141|Ga0268326_1014264 | Not Available | 505 | Open in IMG/M |
| 3300028150|Ga0268343_1011780 | Not Available | 603 | Open in IMG/M |
| 3300028154|Ga0268341_1014164 | Not Available | 647 | Open in IMG/M |
| 3300028248|Ga0268312_1012640 | Not Available | 713 | Open in IMG/M |
| 3300028381|Ga0268264_11469467 | Not Available | 692 | Open in IMG/M |
| 3300028471|Ga0268323_1006123 | Not Available | 728 | Open in IMG/M |
| 3300028472|Ga0268315_1001206 | Not Available | 1236 | Open in IMG/M |
| 3300028473|Ga0268319_1016316 | Not Available | 571 | Open in IMG/M |
| 3300028474|Ga0268331_1019729 | Not Available | 565 | Open in IMG/M |
| 3300028474|Ga0268331_1023273 | Not Available | 536 | Open in IMG/M |
| 3300028475|Ga0268327_1008423 | Not Available | 713 | Open in IMG/M |
| 3300032466|Ga0214503_1067512 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1091 | Open in IMG/M |
| 3300032467|Ga0214488_1025275 | Not Available | 1240 | Open in IMG/M |
| 3300032467|Ga0214488_1104531 | Not Available | 611 | Open in IMG/M |
| 3300032469|Ga0214491_1023311 | Not Available | 1401 | Open in IMG/M |
| 3300032490|Ga0214495_1072324 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 803 | Open in IMG/M |
| 3300032551|Ga0321339_1026002 | Not Available | 1259 | Open in IMG/M |
| 3300032551|Ga0321339_1047208 | Not Available | 977 | Open in IMG/M |
| 3300032591|Ga0214484_1033465 | Not Available | 1064 | Open in IMG/M |
| 3300032591|Ga0214484_1035044 | Not Available | 1044 | Open in IMG/M |
| 3300032591|Ga0214484_1104673 | Not Available | 580 | Open in IMG/M |
| 3300032592|Ga0214504_1024854 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1146 | Open in IMG/M |
| 3300032593|Ga0321338_1095679 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1038 | Open in IMG/M |
| 3300032689|Ga0214497_1034978 | Not Available | 1090 | Open in IMG/M |
| 3300032697|Ga0214499_1035376 | Not Available | 1417 | Open in IMG/M |
| 3300032697|Ga0214499_1041733 | Not Available | 1324 | Open in IMG/M |
| 3300032697|Ga0214499_1058536 | Not Available | 1143 | Open in IMG/M |
| 3300032758|Ga0314746_1027646 | Not Available | 1254 | Open in IMG/M |
| 3300032758|Ga0314746_1041792 | Not Available | 1051 | Open in IMG/M |
| 3300032761|Ga0314733_1024032 | Not Available | 1119 | Open in IMG/M |
| 3300032761|Ga0314733_1041721 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 875 | Open in IMG/M |
| 3300032791|Ga0314748_1036957 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1027 | Open in IMG/M |
| 3300032791|Ga0314748_1055394 | Not Available | 845 | Open in IMG/M |
| 3300032792|Ga0314744_1096485 | Not Available | 560 | Open in IMG/M |
| 3300032812|Ga0314745_1096659 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 617 | Open in IMG/M |
| 3300032822|Ga0314740_1025328 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 883 | Open in IMG/M |
| 3300032844|Ga0314743_1030802 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1224 | Open in IMG/M |
| 3300032844|Ga0314743_1096138 | Not Available | 682 | Open in IMG/M |
| 3300032875|Ga0314737_1023664 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1042 | Open in IMG/M |
| 3300032889|Ga0314751_1033197 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1034 | Open in IMG/M |
| 3300032890|Ga0314747_1015108 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1152 | Open in IMG/M |
| 3300032890|Ga0314747_1016328 | Not Available | 1111 | Open in IMG/M |
| 3300032916|Ga0314734_1088018 | Not Available | 618 | Open in IMG/M |
| 3300032918|Ga0314726_108609 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1134 | Open in IMG/M |
| 3300032934|Ga0314741_1024012 | Not Available | 1328 | Open in IMG/M |
| 3300032934|Ga0314741_1045666 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1008 | Open in IMG/M |
| 3300032976|Ga0314752_1111206 | Not Available | 526 | Open in IMG/M |
| 3300033523|Ga0314768_1032908 | Not Available | 1634 | Open in IMG/M |
| 3300033525|Ga0314758_1070691 | Not Available | 978 | Open in IMG/M |
| 3300033526|Ga0314761_1017917 | Not Available | 1433 | Open in IMG/M |
| 3300033526|Ga0314761_1041147 | Not Available | 1010 | Open in IMG/M |
| 3300033530|Ga0314760_1022608 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 1473 | Open in IMG/M |
| 3300033531|Ga0314756_1040434 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 827 | Open in IMG/M |
| 3300033532|Ga0314767_1104747 | Not Available | 706 | Open in IMG/M |
| 3300033534|Ga0314757_1057161 | Not Available | 933 | Open in IMG/M |
| 3300033535|Ga0314759_1016389 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta | 1888 | Open in IMG/M |
| 3300033535|Ga0314759_1019723 | Not Available | 1776 | Open in IMG/M |
| 3300033537|Ga0314766_1130406 | Not Available | 907 | Open in IMG/M |
| 3300033538|Ga0314755_1068603 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 894 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 83.19% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 11.06% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.77% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.33% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 1.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.44% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
| 3300009995 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015306 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015309 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015315 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015318 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028058 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028064 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028139 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028140 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028141 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028471 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028474 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032791 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032822 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032890 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032918 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032976 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033523 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033531 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033532 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033534 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033537 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033538 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0068861_1020849833 | 3300005719 | Switchgrass Rhizosphere | YDGRDKNTNSQTNGSIKYISNAHENVMQNEIYCN* |
| Ga0068858_1023414952 | 3300005842 | Switchgrass Rhizosphere | VFMYDGRDKNINSQTNGSIKFILIIYGGVMQYEIYSN* |
| Ga0068860_1026067881 | 3300005843 | Switchgrass Rhizosphere | MYDGRDKNINSQTNSSTKHVLNAYGGVMQNKIYYN* |
| Ga0105247_118267461 | 3300009101 | Switchgrass Rhizosphere | MCHHVFMYDGRDKANNSQTISSTKYISNTCGDEIQNEISIVTK* |
| Ga0105133_1144291 | 3300009981 | Switchgrass Associated | DICHHVFMYDGRYKNTNSQTNNSSKHILNTYGGAPNKIYCN* |
| Ga0105132_1124271 | 3300009990 | Switchgrass Associated | DICHHIFMYDIRDKNINSQTNSSIKYTSNTYGGVMQNEIYCN* |
| Ga0105139_10696611 | 3300009995 | Switchgrass Associated | FMYDGRDKNTNSQTNDSFKYISDTNGGVMHNEGIGTCG* |
| Ga0134128_128102661 | 3300010373 | Terrestrial Soil | MYDGRDKNINSQTNSSTKHILYTYGGAQNETIVTK |
| Ga0134127_135497801 | 3300010399 | Terrestrial Soil | MCHHVFMYDERDKNTNSQTNGSTKYILNIHADVMQNEIYCN* |
| Ga0134123_131650021 | 3300010403 | Terrestrial Soil | RYMSPYNGRDKNTTSQTNYSTKHILNTYGVAQNEIYCN* |
| Ga0163163_129850921 | 3300014325 | Switchgrass Rhizosphere | ILPMMCHHVFMYDGRDKTTNSQTNSSKTKYISNTCGGGMQNEIYCN* |
| Ga0157379_121326501 | 3300014968 | Switchgrass Rhizosphere | NQHVFMYDGRDKNTNSQIYSSIKYISNTCGGVMQNKIGCK* |
| Ga0182183_10475721 | 3300015270 | Switchgrass Phyllosphere | YDGRDKNTNSQTIGSIKYISNTHGGVMQNKIYYN* |
| Ga0182099_10522422 | 3300015278 | Switchgrass Phyllosphere | MLLFTTHPMCYHMFMYDEKDKNTNSQTNGSIKYISNIHGDVMQNEICCN* |
| Ga0182100_10552881 | 3300015280 | Switchgrass Phyllosphere | YDGRCKNTNLQTNSSTKYISNTYRGVIQNEIYCN* |
| Ga0182101_10269452 | 3300015284 | Switchgrass Phyllosphere | FMYYERDKNINSQRNGSINYISNEQGGVIQNEIY* |
| Ga0182101_10658741 | 3300015284 | Switchgrass Phyllosphere | IFMYDARDKNTNSQTNRSTKYILNTYGGAQNEIYCN* |
| Ga0182105_10541301 | 3300015290 | Switchgrass Phyllosphere | NISRDIYHHISMYDERDRNINSQTNSSTKHTSNPYGGEMRNKIYCK* |
| Ga0182103_10447101 | 3300015293 | Switchgrass Phyllosphere | CHYIFMYDGRDKNINSQTNNSTKHILNIYGCVMQNEIYYN* |
| Ga0182103_10895101 | 3300015293 | Switchgrass Phyllosphere | HDICHHIFMYDGRNKNTNSQTNSSTKHILNTYGGVM* |
| Ga0182104_10321601 | 3300015297 | Switchgrass Phyllosphere | NTNHDICHHIFMYDGRDKNTNSQINTLTKYIWNTYGGVMQNKIYCN* |
| Ga0182104_10332542 | 3300015297 | Switchgrass Phyllosphere | FMYDGRHKDTNSQTNSSTKYISNAYGDMMQNEIYCN* |
| Ga0182104_10826641 | 3300015297 | Switchgrass Phyllosphere | THDMGHHVFIYVGRDKNTNSQENSSIKYISNTHGGVMQNKIYCN* |
| Ga0182184_10582951 | 3300015301 | Switchgrass Phyllosphere | DMCHHVFMYDRRDQNNNSQTNASIKYILNNRHAMQNEIK* |
| Ga0182184_10625131 | 3300015301 | Switchgrass Phyllosphere | YIFMYDGRDKNINSQTNSSTKHILNTYGGVMQNEIYCN* |
| Ga0182180_10870791 | 3300015306 | Switchgrass Phyllosphere | MIYVTILINDGRDNNTNSQTNSSTEHILNIYGGAQNEIYCN* |
| Ga0182098_10691182 | 3300015309 | Switchgrass Phyllosphere | KILPTMCHHVFMYDGRDKTNNSQTISSTKYISNTCGDEMQNEISIVTK* |
| Ga0182098_10993671 | 3300015309 | Switchgrass Phyllosphere | ICHHVFMYGGRDKTTNSKTNSSTKYMSNKFGGVMQNEIYRN* |
| Ga0182098_11054081 | 3300015309 | Switchgrass Phyllosphere | RVFFNICHHIFMYDGRDKNTNSQTNNSTKHILNAYGGAQNEIYCN* |
| Ga0182098_11250121 | 3300015309 | Switchgrass Phyllosphere | HVGMYDGRGKNSNLQINDSIKCILNTYGGVMQTKIYCN* |
| Ga0182162_10448041 | 3300015310 | Switchgrass Phyllosphere | TTYDICHHIFMYDARDKNTNSQTNRSTKYILNTYGGAQNEIYCN* |
| Ga0182162_10511891 | 3300015310 | Switchgrass Phyllosphere | DMCHHLFMYDGRDKNINSQTDGSIKYISNTHGGVMQNEIYCN* |
| Ga0182162_11124241 | 3300015310 | Switchgrass Phyllosphere | DGRDKTTNSQTNSSTIYIYIYINTCGGGMQNEIYCN* |
| Ga0182182_10784081 | 3300015311 | Switchgrass Phyllosphere | TTHDMCHHILMYDERDKNTNSQTNSSIKYISNTHGGVMQNKI* |
| Ga0182168_10163881 | 3300015312 | Switchgrass Phyllosphere | KICHHIFMYDESDKNINSQINDSIKYMSNLHGGVMQNKIYYN* |
| Ga0182168_10440631 | 3300015312 | Switchgrass Phyllosphere | MYDGRDKNINSQTNSSTKHVLNAYGGVMENKIYYN* |
| Ga0182168_10939701 | 3300015312 | Switchgrass Phyllosphere | HDICHHIFIYDGRDKNTNSQINSSTKHILNAYGGAQNKIYCN* |
| Ga0182168_11295571 | 3300015312 | Switchgrass Phyllosphere | MWHHIFIYDGRDKNINLQTNSSTKHILNTYRGAQNEIYCN* |
| Ga0182168_11315971 | 3300015312 | Switchgrass Phyllosphere | MYDERDKNTNSQTNSSIKYISNTHGGVMQKEIYCK* |
| Ga0182164_10548401 | 3300015313 | Switchgrass Phyllosphere | MCHHVFVYDEGDKNTNSHTNDLIKYISNTVGGVMQNEIYCNYKMN* |
| Ga0182164_10954971 | 3300015313 | Switchgrass Phyllosphere | HVFMYDERNKNINLQTNSSTKYTSNTYGGVMQNKIYCN* |
| Ga0182164_11005831 | 3300015313 | Switchgrass Phyllosphere | MCHHVFMYDRKDKNTNSQTNGSIKYISNTHRGVMQNEIYCN |
| Ga0182164_11041061 | 3300015313 | Switchgrass Phyllosphere | HHVFMYDGRDMNTNLKINYLIEYISNTYGGVMQNEIYCN* |
| Ga0182164_11352632 | 3300015313 | Switchgrass Phyllosphere | CHHAFMNDGRDKNTSSETNSSTKYISNIYGGVMQNEL* |
| Ga0182120_10387352 | 3300015315 | Switchgrass Phyllosphere | MMCHHVFMYDGRDKTINSQTNSSAKYISNTYGGGMQNEISCN* |
| Ga0182121_10802711 | 3300015316 | Switchgrass Phyllosphere | HHVFTYDGKDKNIRSQTNDSIKYISNTRGVEMQNEIYCN* |
| Ga0182136_10353901 | 3300015317 | Switchgrass Phyllosphere | FMYDVRDKNINSQTNSSIKYTSNTYGGVMQNEIYTN* |
| Ga0182136_10800571 | 3300015317 | Switchgrass Phyllosphere | MHHHIFMYDGRDKTINSQTNSSAKYISNTYGGGMQNEIYFD* |
| Ga0182181_10261861 | 3300015318 | Switchgrass Phyllosphere | DIYHHIFMYDGRDKNTNSQTNSLTKHILNTYGGAQNEIYCN* |
| Ga0182181_10489701 | 3300015318 | Switchgrass Phyllosphere | HHIFMYDGRDKNINSQTNSSTKHILNTYGGAQNKIHCN* |
| Ga0182181_10833291 | 3300015318 | Switchgrass Phyllosphere | MCHHVFMYDGRDKTNNSQTISSTKYISNTCGDEMQNEISIVTK* |
| Ga0182165_11435671 | 3300015320 | Switchgrass Phyllosphere | YDERDKNTNSKRNGSVKYISNAHGDVMKNKIYCN* |
| Ga0182148_10097441 | 3300015325 | Switchgrass Phyllosphere | NTTHDICHHIFMYGGRDKNISSQTNSSTKHILNTYGCAKNKIYYN* |
| Ga0182148_11190191 | 3300015325 | Switchgrass Phyllosphere | MCHHIFMHDGRDKNTNSQTNGSIKYISNIHGGVIQNEYIVTS* |
| Ga0182166_10155991 | 3300015326 | Switchgrass Phyllosphere | NVYHHVFTYDGKDKNIRSQTNDSIKYISNTRGVEMQNEIYCN* |
| Ga0182166_10388081 | 3300015326 | Switchgrass Phyllosphere | FIYDGRHKNTNSQTNSSIKYILNTYGGAQNKIYYN* |
| Ga0182114_11352061 | 3300015327 | Switchgrass Phyllosphere | CHHIFIYDGRDKNTNSQINSLTKDILNTYGGAQNEIYCN* |
| Ga0182114_11387331 | 3300015327 | Switchgrass Phyllosphere | HHIFMYDGRDSNTNSQTNSSTEHILNIYGGAQNEIYCN* |
| Ga0182114_11495051 | 3300015327 | Switchgrass Phyllosphere | NTTLDMCHHLFMYDERDKSINSQTNGSIKCISNIHGSMMQNEIYYN* |
| Ga0182153_10142011 | 3300015328 | Switchgrass Phyllosphere | MHDGRDKNINSQIKSSTKHILNTYGCVQNEIYCN* |
| Ga0182153_10775501 | 3300015328 | Switchgrass Phyllosphere | FMYDVRDKNTNLQTNGSIKYISNTYIYEGVLQNKIYCN* |
| Ga0182153_11326101 | 3300015328 | Switchgrass Phyllosphere | MYHERDKNTTSQTNSSIKYISNTYGGMVQNKIYCNRIIIN |
| Ga0182153_11385181 | 3300015328 | Switchgrass Phyllosphere | FMYDGKYKNTN*QTNSSTKHVLNAYGGVMQNEIYCN* |
| Ga0182135_10198961 | 3300015329 | Switchgrass Phyllosphere | MCQHAFMYDGRDKNTNSQTNSSIKYISNIYGGVMKIKIYCN* |
| Ga0182135_10478651 | 3300015329 | Switchgrass Phyllosphere | KNTSHDICHHIFMYDGGDKNTNSQVNSATKYISNTYGGVMQNEIYCN* |
| Ga0182135_11149501 | 3300015329 | Switchgrass Phyllosphere | HDICHHIFMYDGRDKITNSKKSSSTKYISNTYGGMMQNEIYSN* |
| Ga0182135_11259551 | 3300015329 | Switchgrass Phyllosphere | FMYDGRDKNTNLQTNSSTKYISNTYGGVVQNEIYCN* |
| Ga0182135_11265251 | 3300015329 | Switchgrass Phyllosphere | FMYDGRDKNNNSQINSSIKYISNMYVVVMQNKIYCNYI* |
| Ga0182152_10742941 | 3300015330 | Switchgrass Phyllosphere | IFMYDGRDKNTNSQKNSSTKHILNTYGCAQNEIYCN* |
| Ga0182131_10452261 | 3300015331 | Switchgrass Phyllosphere | YFYIKILPAICVTGHVFMYDGRDKNTNSQINSSTKYKSNTYGGAQNEIYCK* |
| Ga0182131_10620011 | 3300015331 | Switchgrass Phyllosphere | IYIIYHHIFIYDGKCKNINSQINGLIKYISNIHGGVMQNKIYCN* |
| Ga0182117_11218661 | 3300015332 | Switchgrass Phyllosphere | MYDGRDKNINSQTNSSIKYISNAHENVMQNEIYCN* |
| Ga0182117_11488761 | 3300015332 | Switchgrass Phyllosphere | SCIMYDGRDKNINLQINSSTKYISNIYEGMMQNKIYCN* |
| Ga0182147_10169141 | 3300015333 | Switchgrass Phyllosphere | YLSPYNGRDKNSNSQINGLIKYILNTHEGAMQNEIHCN* |
| Ga0182132_10848321 | 3300015334 | Switchgrass Phyllosphere | MIYVTILMYDGRDNNTNSQTNSSTEHILNIYGGAQNEIYCN* |
| Ga0182116_10556322 | 3300015335 | Switchgrass Phyllosphere | YKNTTGDICRHIFMFDGRDKNINLQTNNSTKHILNTYEGSQNEIYCN* |
| Ga0182116_10836751 | 3300015335 | Switchgrass Phyllosphere | IYYRRDNSTNSQTNISTKYVSNTYGGAMQNKIYCN* |
| Ga0182116_11058211 | 3300015335 | Switchgrass Phyllosphere | KNTTHNICHHMFMYDERNKNTNSQTNSSTKHILNTYGGVI* |
| Ga0182116_11677591 | 3300015335 | Switchgrass Phyllosphere | MYDGRDNNVNTQTNSSTKHILNTCGGAQNEIYCN* |
| Ga0182150_10618461 | 3300015336 | Switchgrass Phyllosphere | MCHHLFMYDERDKSINSQTNGSIKYISNIHGSMMQNEICCNYIMI |
| Ga0182151_10012793 | 3300015337 | Switchgrass Phyllosphere | MCHHVFMYDGRDKNTDSQTIYSIRYISNTYGGEMQNEISIAIR* |
| Ga0182151_10088531 | 3300015337 | Switchgrass Phyllosphere | VFMYDERDKNTNSQTNSSIKYISNTHGGVMQKEIYCK* |
| Ga0182151_10889552 | 3300015337 | Switchgrass Phyllosphere | YDGRDKNTNSQTNSSTKHILNTYGGVMQNEIYCN* |
| Ga0182149_10139292 | 3300015339 | Switchgrass Phyllosphere | FMYDGRDKNTNSQTNSSTKHILNTYGGVMQNEIYCN* |
| Ga0182149_10636601 | 3300015339 | Switchgrass Phyllosphere | MYNGRDKNTNSQTNGSIKYISNKHGGVMQNETTI* |
| Ga0182149_11047371 | 3300015339 | Switchgrass Phyllosphere | HHIFMYDGRDKNTNSQTNSSTKHILNTYGGAQNKIYYN* |
| Ga0182133_11190571 | 3300015340 | Switchgrass Phyllosphere | YDERDKNTNSQINSSTKYISSTYGGVMQNEIYTN* |
| Ga0182133_11401961 | 3300015340 | Switchgrass Phyllosphere | HDICHHIFKYDGRDKNVNSQINSSIKYILNTYGGVMQNEIYCN* |
| Ga0182115_10611252 | 3300015348 | Switchgrass Phyllosphere | YDGRDKNTNSKTKSSTKYILNTYGGVMQNKPIVTR* |
| Ga0182115_11523211 | 3300015348 | Switchgrass Phyllosphere | VYHHVFTYDGKDKNIRSQTNDSIKYISNTRGVEMQNEIY |
| Ga0182115_11564141 | 3300015348 | Switchgrass Phyllosphere | IYDGRGKNTNSQTNSSTKYISNTYLGVIQNEIYCN* |
| Ga0182115_11675701 | 3300015348 | Switchgrass Phyllosphere | NTTHDMCHHEFMYDEKGKNTNSQTNSSIKYMSNTYGDVM* |
| Ga0182115_11980951 | 3300015348 | Switchgrass Phyllosphere | MYDGRDNNTNSQTNDSFKYISDTNGGVMHNEGIGTCG |
| Ga0182115_12037421 | 3300015348 | Switchgrass Phyllosphere | HIFMYDERDKNINSQINSSTKYISNTYGDVMQNKIDLL* |
| Ga0182115_12860831 | 3300015348 | Switchgrass Phyllosphere | KNTTHDICHHIFMHDGRDKNINSQINSRTKHILNTYGCVQNEIYCN* |
| Ga0182185_10633292 | 3300015349 | Switchgrass Phyllosphere | KNTTHDICHHIFMYDGRDKNTNSQTNSSIKHALYAYEGVMQNEIYCN* |
| Ga0182185_11303241 | 3300015349 | Switchgrass Phyllosphere | YKNTIHNIYHRVFMYDGRDKNTNSQTNSLTIYISNTYEGVMQNERYYN* |
| Ga0182185_11766151 | 3300015349 | Switchgrass Phyllosphere | DMCHHIFMYDGRDKNINSQTNSSIKYMSDIYGGGMQSEI* |
| Ga0182185_12487561 | 3300015349 | Switchgrass Phyllosphere | LHVFIYDGRDKNTNSQANSSIKYISNIYGGVMQNKINTTT* |
| Ga0182163_10594821 | 3300015350 | Switchgrass Phyllosphere | MCRHVFIYDGRDKTTNSQTNVSIKYISNIHGGVMQNKIYIN* |
| Ga0182163_10686071 | 3300015350 | Switchgrass Phyllosphere | VFMYYERDKNINSQRNGSINYISYEHGGVIQNEIY* |
| Ga0182163_11001311 | 3300015350 | Switchgrass Phyllosphere | DERDKDTNLQTNNSKTNSSTKYILNTYGGAQNKIYCN* |
| Ga0182163_11489282 | 3300015350 | Switchgrass Phyllosphere | MCHHVSMYDERDKNINSQTNGSLKYISNTYGGAMQNEIYCN* |
| Ga0182163_11742421 | 3300015350 | Switchgrass Phyllosphere | IFMYNGRDKNTNSQINSSTKHVLNTYGG*QNEIYCN* |
| Ga0182163_12869032 | 3300015350 | Switchgrass Phyllosphere | YDGRDKNINSQTNSSTKHTSNIYGGVIQNEIYCN* |
| Ga0182169_10139364 | 3300015352 | Switchgrass Phyllosphere | HNICHHIFMYDERDKNTNSHTNSSTKHILNAYGGVM* |
| Ga0182169_10387061 | 3300015352 | Switchgrass Phyllosphere | MCHHVFMYDERDNNTNSQTNGSIKYISNTNGGVMQNEIYCN* |
| Ga0182169_10688261 | 3300015352 | Switchgrass Phyllosphere | MCHHVFMYERRYKNTNSQANGSINYISNTHGGVMQNKIYC |
| Ga0182169_11207401 | 3300015352 | Switchgrass Phyllosphere | HHIFMYDGRDKNTNSQTNISTKHILNTYGGAQNEIYCN* |
| Ga0182169_11526741 | 3300015352 | Switchgrass Phyllosphere | MCHHLFMYDERDKSINSQTNGSIKCISNIHGSMMQNEICCNYIM |
| Ga0182169_11955701 | 3300015352 | Switchgrass Phyllosphere | MYDGRDNNTNSQTNSSIKYISNTYGGVMQNEIFYN* |
| Ga0182169_12187201 | 3300015352 | Switchgrass Phyllosphere | KNTTHDICHHIFMYDGRDKNTNSQINSSTKYKSNTYGGAQNEIYCK* |
| Ga0182169_12284121 | 3300015352 | Switchgrass Phyllosphere | VYINTIHNICHHIFMYGGKDKNTHFQTNSSTKHILNTYGSVMQNEIYCN* |
| Ga0182169_12408821 | 3300015352 | Switchgrass Phyllosphere | MHDGRDKNTNSQTNGSIKFIPNKKNKHGVVMQNKISCN* |
| Ga0182169_12759191 | 3300015352 | Switchgrass Phyllosphere | KYTIHGICHHVFMYYERDKNINSQRNGSINYISNEHGGVMQNEIYRN* |
| Ga0182179_10122591 | 3300015353 | Switchgrass Phyllosphere | MCHRIFMYDGRDKNTNSQTNGSIKYISNTYEGVMHNGTYCN* |
| Ga0182179_10205741 | 3300015353 | Switchgrass Phyllosphere | YENTTHDICHHIFMYDGRDKTTNLKTNSLTEYISNKCGGMMQNEIYRN* |
| Ga0182179_10508441 | 3300015353 | Switchgrass Phyllosphere | THDMCHHIFIYDGRDKNTSSQTNGSIKYISNTHGDVMQNKIHCN* |
| Ga0182179_10754542 | 3300015353 | Switchgrass Phyllosphere | ICHHVFMYYERDKNINSQRNGSINYISNKQGGVIQNEIY* |
| Ga0182179_11466511 | 3300015353 | Switchgrass Phyllosphere | IFMYDERDKNINSQINSSTKYISNTYGDVMQNKIDLL* |
| Ga0182179_11896062 | 3300015353 | Switchgrass Phyllosphere | AFMYDGRDKNTNSQTNSSIKYISNIYGVMKIKIYCN* |
| Ga0182179_12464341 | 3300015353 | Switchgrass Phyllosphere | LYDGRYKNINSQINSLTKHILNTYGCAQNKIYYN* |
| Ga0182167_10007931 | 3300015354 | Switchgrass Phyllosphere | KNTTHDIFYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM* |
| Ga0182167_10368971 | 3300015354 | Switchgrass Phyllosphere | NTTHNMYHHVFMYDGTDKNTNSETNVSAIKYILNTHGGVMQNEVYCN* |
| Ga0182167_10431581 | 3300015354 | Switchgrass Phyllosphere | KDITHDICHHIFKYDGRDKNTNSQINSSIKHIFNTKNGGAHNEIYCN* |
| Ga0182167_10443791 | 3300015354 | Switchgrass Phyllosphere | MCHHVFMYDRRDQNNNSQTNASIKYILNNRRAMQNEIK* |
| Ga0182167_11045601 | 3300015354 | Switchgrass Phyllosphere | FILLFIENTTHDICHHLFMYYGRDKNINSQTNNSTKNILKTYGGVM* |
| Ga0182167_11346621 | 3300015354 | Switchgrass Phyllosphere | HIFMYDGRDKTTNSQTNSSTIYISNICGGGMQNKIYCN* |
| Ga0182167_11721741 | 3300015354 | Switchgrass Phyllosphere | VTMYSYDVRDKKTNSQTNVSIKYISNTYGGVMQNEFYCN* |
| Ga0182167_13405771 | 3300015354 | Switchgrass Phyllosphere | MYDGRDKNTNSQINSPTKYISNTHTAMQNKIYYN* |
| Ga0182199_10753151 | 3300017412 | Switchgrass Phyllosphere | VFVYDEEDKNTNSHTNDLIKYISNTVGGVMQNEIYCNYKMN |
| Ga0182199_11440801 | 3300017412 | Switchgrass Phyllosphere | PYIHQFIYDRRDKNTNSQTNSSIKHILNTYGGAQNEIYCN |
| Ga0182195_11177361 | 3300017414 | Switchgrass Phyllosphere | MCHHVFMGDVRDKNINSERNSSIKYMSDIYGGGMQSEI |
| Ga0182195_11504571 | 3300017414 | Switchgrass Phyllosphere | ICHHIFMYDGRDKNINSQTNSSTKYTSNTYGGVIQNEIYCN |
| Ga0182195_12146591 | 3300017414 | Switchgrass Phyllosphere | HVFIYDGRDKNTNSQANSSIKYISNIYGGVMQNKINTTT |
| Ga0182213_11943181 | 3300017421 | Switchgrass Phyllosphere | HHIFMHDGRDKNINSQINSSTKHILNTYGCVQNEIYCN |
| Ga0182201_10794721 | 3300017422 | Switchgrass Phyllosphere | MCRHAFIYDGRDKTTNSQTNVSIKYISNIHGGVMQNKIYIN |
| Ga0182196_10378082 | 3300017432 | Switchgrass Phyllosphere | VFMYDERDKNTNSQTNSSIKYISNTHGGVMQKEIYCK |
| Ga0182196_10601422 | 3300017432 | Switchgrass Phyllosphere | MCHHVFMYDKRDKNTNSPTNGSIKYISNPYRGVMQNE |
| Ga0182196_11335371 | 3300017432 | Switchgrass Phyllosphere | MCHHIFMYDGKDKNINSQTNSSTKYISNTYGDVMQ |
| Ga0182200_10916551 | 3300017439 | Switchgrass Phyllosphere | MCHHVFMYDERDKTTNSQTNSSTKYILNTCGGGKQNEIYYN |
| Ga0182200_11044331 | 3300017439 | Switchgrass Phyllosphere | IYMYDERDKNTNSQTNSSTKYISSTYGGVMQNEIYTN |
| Ga0182214_10905701 | 3300017440 | Switchgrass Phyllosphere | CHHVFMYDGKDKNTNLQTNSXTKYISNTYGGVMQKXNLL |
| Ga0182214_11277152 | 3300017440 | Switchgrass Phyllosphere | ITHDICHHIFMYDGRDKNINSQKNSSTKHVLNAYGGVMQNEIYYN |
| Ga0182214_11378371 | 3300017440 | Switchgrass Phyllosphere | FMYNERDKNTNSQINSSTKHVLNTYGGAQNEIYCN |
| Ga0182198_10654391 | 3300017445 | Switchgrass Phyllosphere | HDICHRIFMYDRRDKNTNSQTNSSTKYILNTYGGVMQNKIYCN |
| Ga0182198_11776281 | 3300017445 | Switchgrass Phyllosphere | IFMYNGKDKNINSQTNSSIKYISSTHGGVMQNKIYCN |
| Ga0182216_10809713 | 3300017693 | Switchgrass Phyllosphere | MCHHVFMYDGRDKYTNSQTNSSIKYISNTHREVMQNK |
| Ga0182216_10986751 | 3300017693 | Switchgrass Phyllosphere | HIFMYDGRDKNTNSQTNSSTKHILNTYGGAQNEIYCN |
| Ga0182216_11379391 | 3300017693 | Switchgrass Phyllosphere | FMYDVRDKNINSQTNNSIKYISNTLGGVMQNEIYCN |
| Ga0182216_11385811 | 3300017693 | Switchgrass Phyllosphere | MCHHVFIYDERDKNTNSQTNGSFKYISNTHEGVMQNEIYYN |
| Ga0182216_12245181 | 3300017693 | Switchgrass Phyllosphere | CHHIFMHDGRDKNTNSQTNGSIKYISNIHGGVIQNEYIVTS |
| Ga0268328_10193981 | 3300028050 | Phyllosphere | SYMMEEINTNSQTNSTIKYISNTYKGVMQNKIYCN |
| Ga0268328_10208321 | 3300028050 | Phyllosphere | MYRIFMYDGRDKNTNSQTNSSTKHILNAYGGAQNEIYCNYI |
| Ga0268328_10211011 | 3300028050 | Phyllosphere | MLHVFIYDGRDKNTNSQANSSIKYISNIYGGVMQNKINTTT |
| Ga0268328_10727911 | 3300028050 | Phyllosphere | YYLYKNITHDICYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM |
| Ga0268346_10445271 | 3300028053 | Phyllosphere | KICHHIFMYDESDKNINSQINDSIKYMSNLHGGVMQNKIYYN |
| Ga0268338_10242021 | 3300028055 | Phyllosphere | KNTTHDICHYIFMYDGRDKNTNSQINNSTKHILNIYGCVMQNEIYCN |
| Ga0268338_10385661 | 3300028055 | Phyllosphere | FMYDGRDKNTNSQTNSSTKHILNTYGAAENEIYCN |
| Ga0268330_10616871 | 3300028056 | Phyllosphere | CIMYDGRDKNINLQINSSTKYISNIYEGMMQNKIYCN |
| Ga0268332_10608862 | 3300028058 | Phyllosphere | MYDGRYKNTNSQTNSSTKHVLNVYGVVMQNKIYCN |
| Ga0268332_10696871 | 3300028058 | Phyllosphere | FMLLVIYMIYDGRDKNINSQXNDSIKYISNTHEDVMQNEIYYN |
| Ga0268314_10312841 | 3300028061 | Phyllosphere | MHDVRDKNINSQTNSSTKYISNTYEDMMQYKIYCN |
| Ga0268340_10584271 | 3300028064 | Phyllosphere | MCHHVFMYDGRDKNNNSQINSSIKYISNMYVVVMQNKIYCNY |
| Ga0268355_10143681 | 3300028139 | Phyllosphere | IFMYDGRDKNTNSQTNSSTKHVLNAYGGVMQNEIYFN |
| Ga0268334_10147581 | 3300028140 | Phyllosphere | GHHIFMYDGRDKNTNSQTNSSTKHILNTYGGVMQNKSIVST |
| Ga0268326_10085441 | 3300028141 | Phyllosphere | YIFMYDGRYKNTNSQTNSSIKYILNTYGGVMQNEIYCN |
| Ga0268326_10142641 | 3300028141 | Phyllosphere | LYKNTTYDICHHIFMYDARDKNTNSQTNRSTKYILNTYGGAQNEIYCN |
| Ga0268343_10117801 | 3300028150 | Phyllosphere | MRHHVFMYDGRDKTTNSQTNSSTKYISNTRGGGMQNEIYCN |
| Ga0268341_10141641 | 3300028154 | Phyllosphere | MSPYIHIYDGRNKNTNSQTNSSTKHILNTYGGAQNEMYC |
| Ga0268312_10126403 | 3300028248 | Phyllosphere | FMYDGRDKNTNSQTNSSTKHILNTYGGVMQNEIYCN |
| Ga0268264_114694672 | 3300028381 | Switchgrass Rhizosphere | HDIYHHIFMYDGRDKNNNSQINSSTKYISNTYGGVMQNEIYYN |
| Ga0268323_10061231 | 3300028471 | Phyllosphere | MCQHAFMYDGRDKNTNSQTNSSIKYISNIYGGVMK |
| Ga0268315_10012061 | 3300028472 | Phyllosphere | HDMCHRIFMYDGRDKNTNSQTNGSIKYISNTYEGVMHNGTYCN |
| Ga0268319_10163161 | 3300028473 | Phyllosphere | MCHHVSMYDGRDKNTNSQTNGSLKYISNTYGGAMQNEIYCN |
| Ga0268331_10197292 | 3300028474 | Phyllosphere | FMYDGRDKNINLQTNGSIRYILNIHGDVMQNKIYCN |
| Ga0268331_10232731 | 3300028474 | Phyllosphere | MCRHVFIYDGRDKTTDSQTNVSIKYISNIHGGVMQNKIYIN |
| Ga0268327_10084231 | 3300028475 | Phyllosphere | NSTDDMCHHVFMYDGRDKNINLQTNGLIKYISNTLGCVMQN |
| Ga0214503_10675122 | 3300032466 | Switchgrass Phyllosphere | MCYHVSMYDGRDKNTNSQTNGLIKYISNTHGGVMQNEIYCN |
| Ga0214488_10252752 | 3300032467 | Switchgrass Phyllosphere | HDICHHIFMYDGRYKNTNSQTNISTKHILNTYGGAQNEIYCN |
| Ga0214488_11045311 | 3300032467 | Switchgrass Phyllosphere | HHVFIYDARDKNINSQINGSVRYISNTHGGVIQNKIYCN |
| Ga0214491_10233111 | 3300032469 | Switchgrass Phyllosphere | HDICHHIFIYDGRDKNTNSQTNISTKHILNTYGGAQNEIYCN |
| Ga0214495_10723241 | 3300032490 | Switchgrass Phyllosphere | HDIYHHIFMYDGRDKNTNSQTNSLTKHILNTYGGAQNEIYCN |
| Ga0321339_10260021 | 3300032551 | Switchgrass Phyllosphere | KNITHDIFYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM |
| Ga0321339_10472081 | 3300032551 | Switchgrass Phyllosphere | HDICHHIFMYDGRDKNTNSQTNISTKHILNTYGGAQNEIYCN |
| Ga0214484_10334651 | 3300032591 | Switchgrass Phyllosphere | RDICYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM |
| Ga0214484_10350441 | 3300032591 | Switchgrass Phyllosphere | VFIYDERDKNTNSETNGLIKYILNTHEGLMQNETYCN |
| Ga0214484_11046731 | 3300032591 | Switchgrass Phyllosphere | MYDGRDKNTNSQTNSSTKHVLNVYGVVMQNKIYCN |
| Ga0214504_10248541 | 3300032592 | Switchgrass Phyllosphere | HNICHRIFMYDGRDKNTNSQTNSSTKHMLNTYGGVMQNEIYCK |
| Ga0321338_10956792 | 3300032593 | Switchgrass Phyllosphere | MCYRVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN |
| Ga0214497_10349781 | 3300032689 | Switchgrass Phyllosphere | HDIFYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM |
| Ga0214499_10353761 | 3300032697 | Switchgrass Phyllosphere | DICHHIFMYDGRDKNTNSQTNSSTKHVLNAYGGVIQYEIYCN |
| Ga0214499_10417331 | 3300032697 | Switchgrass Phyllosphere | HDICYHIFMYDGRDKNNNSQTKSSTKHILNAYGGVM |
| Ga0214499_10585361 | 3300032697 | Switchgrass Phyllosphere | HDICHHIFMYDGRDKNTSSQTKGSTKHILNTYGGAQNEIYCN |
| Ga0314746_10276461 | 3300032758 | Switchgrass Phyllosphere | NTTHDICHHIFMYDGRDKNTNSQTNSSTKHVLNAYGGVIQYEIYCN |
| Ga0314746_10417921 | 3300032758 | Switchgrass Phyllosphere | DICHHIFMYDGRYKNTNSQTNISTKHILNTYGGAQNEIYCN |
| Ga0314733_10240321 | 3300032761 | Switchgrass Phyllosphere | HDICHHIFIYDGRDKNTNSQINSLTKDILNTYGGAQNEIYCN |
| Ga0314733_10417212 | 3300032761 | Switchgrass Phyllosphere | CYHVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCS |
| Ga0314748_10369572 | 3300032791 | Switchgrass Phyllosphere | MCYHVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN |
| Ga0314748_10553941 | 3300032791 | Switchgrass Phyllosphere | HDICRHIFMYDGRDKNTNSQTNSSTKHVLNAYGGVIQYEIYCN |
| Ga0314744_10964851 | 3300032792 | Switchgrass Phyllosphere | MYDGRDKNTNSQTNSSTKHVLNAYGGVIQYEIYCN |
| Ga0314745_10966591 | 3300032812 | Switchgrass Phyllosphere | HHIFMHDGRDENINSQANSSTKHILNTYECAQNEIYCN |
| Ga0314740_10253282 | 3300032822 | Switchgrass Phyllosphere | YDMCYHVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN |
| Ga0314743_10308021 | 3300032844 | Switchgrass Phyllosphere | MYYHVFMYDGRDKTTNSQTNSSTKYIYISNTCGGGMQNEIYYN |
| Ga0314743_10961381 | 3300032844 | Switchgrass Phyllosphere | HDICYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM |
| Ga0314737_10236641 | 3300032875 | Switchgrass Phyllosphere | PFVIGSAIMYGGRDKNINSQTNGSIKYRLNTHGGVMQNKIYCNN |
| Ga0314751_10331972 | 3300032889 | Switchgrass Phyllosphere | MCYHVSMYDGRDKNTNSQTNGSIKYISNTYGGVMQNEIYCN |
| Ga0314747_10151081 | 3300032890 | Switchgrass Phyllosphere | TTHDICHHIFMFDGRDKNINSQTNSSTKHILNTYGGVMQNEIYCN |
| Ga0314747_10163281 | 3300032890 | Switchgrass Phyllosphere | NTTHDICHHIFMYDGRDKNTSSQTKGSTKHILNTYGGAQNEIYCN |
| Ga0314734_10880182 | 3300032916 | Switchgrass Phyllosphere | DICHHIFMFDGRDKNINSQANSSTKHILNTYGGVMQNEIYCN |
| Ga0314726_1086091 | 3300032918 | Switchgrass Phyllosphere | KTTHDICHHIFMFDGRDKNINSQTNSSTKHILNTYGGVMQNEIYCN |
| Ga0314741_10240121 | 3300032934 | Switchgrass Phyllosphere | APDICYHIFMYDGRDKNNNSQTNSSTKHILNAYGGVM |
| Ga0314741_10456661 | 3300032934 | Switchgrass Phyllosphere | IHSICHHVFMYYERDKNINSQTNGSIKYISNEHGGVMQNEIY |
| Ga0314752_11112061 | 3300032976 | Switchgrass Phyllosphere | MRHHVFMYDGRDKTTNSQTNSSTKYIYISNTCGGGMQNEIYYN |
| Ga0314768_10329081 | 3300033523 | Switchgrass Phyllosphere | MCYHVSMYDGRDKNINSQTNGSIKYISNTHGGVMQNEIY |
| Ga0314758_10706911 | 3300033525 | Switchgrass Phyllosphere | HIFMFDGRDKNINSQTNSSTKHILNTYGGVMQNEICCN |
| Ga0314761_10179171 | 3300033526 | Switchgrass Phyllosphere | SAIMYGGRDKNINSQTNGSIKYRLNTHGVVMQNKIYCN |
| Ga0314761_10411471 | 3300033526 | Switchgrass Phyllosphere | AHDICHHIFMYDGRDKNTSSQTKGSTKHILNTYGGAQNEIYCN |
| Ga0314760_10226082 | 3300033530 | Switchgrass Phyllosphere | MCYHVSMYDGRDKNINSQTNGSIKYISNTHGGVMQNEIYCN |
| Ga0314756_10404341 | 3300033531 | Switchgrass Phyllosphere | HVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN |
| Ga0314767_11047471 | 3300033532 | Switchgrass Phyllosphere | MYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN |
| Ga0314757_10571611 | 3300033534 | Switchgrass Phyllosphere | THDICHHIFMYDGRDKNTSSQTKGSTKHILNTYGGAQNEIYCN |
| Ga0314759_10163892 | 3300033535 | Switchgrass Phyllosphere | ATHDICHHIFMYDGRYKNTNSQTNISTKHILNTYGGAQNEIYCN |
| Ga0314759_10197231 | 3300033535 | Switchgrass Phyllosphere | HVFMYDGRDKNIQIDDSIKYISNTCKDVMQNEIYFN |
| Ga0314766_11304061 | 3300033537 | Switchgrass Phyllosphere | DICHHIFMFDGRDKNINSQTNNSTKHILNTYGGVMQNEICCN |
| Ga0314755_10686031 | 3300033538 | Switchgrass Phyllosphere | NITYDMCYHVSMYDGRDKNTNSQTNGSIKYISNTHGGVMQNEIYCN |
| ⦗Top⦘ |