NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032826

3300032826: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032826 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330586 | Ga0314732
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size43397660
Sequencing Scaffolds27
Novel Protein Genes32
Associated Families30

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2
Not Available8
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae3
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae → Ourmiavirus → unclassified Ourmiavirus → Erysiphe necator associated ourmia-like virus 881
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1
All Organisms → cellular organisms → Eukaryota → Opisthokonta1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum4
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3951Long. (o)-85.3736Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000459Metagenome / Metatranscriptome1109Y
F001543Metagenome / Metatranscriptome673Y
F002654Metagenome / Metatranscriptome539Y
F002974Metagenome / Metatranscriptome516Y
F012546Metagenome / Metatranscriptome279Y
F012944Metagenome / Metatranscriptome275Y
F014470Metatranscriptome262Y
F015691Metagenome / Metatranscriptome252Y
F016911Metagenome / Metatranscriptome243Y
F018302Metagenome / Metatranscriptome235Y
F018668Metagenome / Metatranscriptome233Y
F019078Metagenome / Metatranscriptome231Y
F020484Metagenome / Metatranscriptome223Y
F026180Metagenome / Metatranscriptome198Y
F030953Metatranscriptome183N
F034039Metagenome / Metatranscriptome175Y
F040414Metagenome / Metatranscriptome161Y
F040444Metagenome / Metatranscriptome161Y
F041531Metatranscriptome159Y
F042712Metagenome / Metatranscriptome157Y
F053748Metagenome / Metatranscriptome140Y
F075544Metagenome / Metatranscriptome118Y
F078016Metatranscriptome116N
F078111Metagenome / Metatranscriptome116Y
F079454Metagenome / Metatranscriptome115Y
F084981Metagenome / Metatranscriptome111Y
F093512Metagenome / Metatranscriptome106N
F102419Metagenome / Metatranscriptome101Y
F104214Metagenome / Metatranscriptome100Y
F106076Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314732_102498All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1630Open in IMG/M
Ga0314732_105892Not Available1205Open in IMG/M
Ga0314732_107028All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1122Open in IMG/M
Ga0314732_107220Not Available1109Open in IMG/M
Ga0314732_109268Not Available993Open in IMG/M
Ga0314732_111096All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae907Open in IMG/M
Ga0314732_111926All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae → Ourmiavirus → unclassified Ourmiavirus → Erysiphe necator associated ourmia-like virus 88877Open in IMG/M
Ga0314732_113539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum821Open in IMG/M
Ga0314732_113872Not Available809Open in IMG/M
Ga0314732_115317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae767Open in IMG/M
Ga0314732_118249All Organisms → cellular organisms → Eukaryota → Opisthokonta697Open in IMG/M
Ga0314732_118993All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii681Open in IMG/M
Ga0314732_119663All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Malpighiales → Rhizophoraceae → Rhizophora → Rhizophora mucronata667Open in IMG/M
Ga0314732_121079All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum641Open in IMG/M
Ga0314732_121923All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum627Open in IMG/M
Ga0314732_122176All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
Ga0314732_123509All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii601Open in IMG/M
Ga0314732_123945Not Available595Open in IMG/M
Ga0314732_126503Not Available560Open in IMG/M
Ga0314732_126965All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum554Open in IMG/M
Ga0314732_127184All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae551Open in IMG/M
Ga0314732_127768All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum544Open in IMG/M
Ga0314732_128466Not Available536Open in IMG/M
Ga0314732_128802Not Available532Open in IMG/M
Ga0314732_129490All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea525Open in IMG/M
Ga0314732_129745All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae522Open in IMG/M
Ga0314732_131895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314732_101620Ga0314732_1016201F002974VQRRPPDAPVHSGIIRRNNDVKRGRGRPILTWKEVVKRDLKDWNITREIALDRATWKAAIHVPEP
Ga0314732_102498Ga0314732_1024981F015691VFIKLGQKHASKDGIELAVFVAFGEVLSFGLGVAELVLVLLLTVRLVDGFSFVHSVVYNVHKQAHNQNTENKDLSLSSNRIHIKCGAQSNIFEWFLNGMAGTKLREA
Ga0314732_105892Ga0314732_1058922F020484MARTLDVARSEIRRDRLQCWDEMDITLLFRINFGRMRTRWKGKFVHFLMEQCFSTCSVLEIERKIREDEAAMGQRGIEGGDDDVKQ
Ga0314732_107028Ga0314732_1070281F001543VFIKTRKKYASKGGIELAVFKAFREVLIEVLPFGFGIVKLVLIDLLAVLLVDEFSLVHTVIYDVYKQTHNSEKEIKVLSLSSN
Ga0314732_107220Ga0314732_1072201F104214VWTVRLGTMSGMYCIEPLGRIYRSTWLGGQVASPRDKEGYPGITINPKLTISRVA
Ga0314732_109268Ga0314732_1092681F034039LKVLGLRLWDHAVVVPDGVQVVANTTLDSVVVFHLTALADHVFPLVVIAFLKWDLICLVLFLTFFQEK
Ga0314732_111096Ga0314732_1110961F014470GHTTYPAYKRERGLRVRRTYTPLPEPSDGCVFPEEMVRITGRDPTPVEQEALRAVQWRHGRWGGSKRDVFSPSCGKVRRSYHYRARPGFSYLSFVGPGKTKLSPLWEKGADWGLVPADFRSEEEERGLAKLEQFRADWDSGFIAIGD
Ga0314732_111926Ga0314732_1119261F078016TMFHRSVFSLNSTYFVTSKSNGPRFAPFIRSSCLFDKIEDCGEVAGRLKGCVVGTGVFRDKVQTFLLTNISSGVFSTQRSLRRGMGCSISTRAIRWSQMDKREEFYLSFPSEPSIPLRKSHWMHNSIPDGYVRSAGVPDSESFNSDMVETAWSRGPISTKYQKDDEYWEYVREGTYRYNPFSAYRFWTMAGGVGEIPRSTLQCARPQKMGWRKQNEGGIAFVSAGFQ
Ga0314732_112508Ga0314732_1125081F030953DDTVISAYRDVTVQDYPSGYRLNNDKTIRAGNAAEVNSTVFLKSKGRWREVRHLRRGGAVADYPGMLHMAKAVTITPGFVDAYQRCRIGRRWGFLPSQLGHKTYPAYKRERGLRVRRTYTPLPEPADGCVFPEEMVRITGRDPTPVEQEALRSVQWKHGRWGGAKRDVFSPSCGKVRRSYHYRARPGFSYLSFVGPGRPKLSPLWEKGADWGLVPASFQTEEEERGLAELEQFRRNWDSGFISVGD
Ga0314732_113539Ga0314732_1135393F079454LALTLTKLVLRTKDLIFMFLDGLDVFLDVYEMSWDSSNLQMAGGAHIYRPPTRTSC
Ga0314732_113872Ga0314732_1138722F093512MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGLLDILLIE
Ga0314732_115317Ga0314732_1153173F040444GEAELSGHPGKEVEEGGEGLRLGAQRESPRVMRKIINNDQIISIARHAEYRRCPQVTVNEIKSMRSMRRRKRKRKSNMTT
Ga0314732_117137Ga0314732_1171371F000459ERVDNVKRGRGRPKLTWDESVKRDLKDWNISKEITLDRSAWRLAINEPEP
Ga0314732_118249Ga0314732_1182491F018668GCSNNQSNPTTPHSLLSTPPPKQHQTIKMAFFKSLIIASVAAVAFAAPQGASDKNTEVKVSGQDNSPKCGNGQKIACCNSGEDLIGLNCLSIPILAIPIQQACGSNVAACCQTGDAEGNLINLEANCLAIPL
Ga0314732_118993Ga0314732_1189932F026180GNGGSCTVHPTARHSAADYREIQKLAKQVGGRREQAFKDGSPTPRQRPGKEKASDGEATAVEKGLGYQSPARELKGVYSHVDTDSGKDERRKKLYVMYGGSSELVSRRDVKTLRREVLSVKPGVPRAAPHHRWRNTTISFGPSDCPENMAGAGVLPLVTAPVISDVRLYHVLIDGGTGLNVISYAAFKQR
Ga0314732_119663Ga0314732_1196631F002654LNYQTFNDKVGCQKGNSPEQVFKVPKFLLSESKEVFKRYNQEIGLEAAIF
Ga0314732_121079Ga0314732_1210792F018302GKKKSFAWEDACHVFAAVRLQAAARGLLARRGLQKMRLEMQEAALTAIDLGNWGRNLGKWGRDLVPSEGRQRSRQLAVVFKRALGSELQFCSSDKGGAFLLVIGGGTSPSAITFRHRPPRGRLRWSLLRLISGGDTCPPLSFRWSPWDPGGYFRAGPAQGGCPPYLQESKIKNCSLFKISRDVKRLVLRSSVCV
Ga0314732_121209Ga0314732_1212091F000459VPVRGGVLKRVDKVKRGRGRPKLTWDESVKRDLKDWDISEELALDRSAWRLAINVPEP
Ga0314732_121499Ga0314732_1214991F000459VRSGVLKRVDKVKRDRGRSKLTCDESVKRDLKDWNISEEVALDRSAWRLAINVPEP
Ga0314732_121923Ga0314732_1219231F019078MSTEQKDLGDSAMGDGEKACPCCHFYGVPCRQIRATEEEATTRRNQRLFSSTKRKRSHQEQLAEDSLFLDSPSVEELQTIQKRKNPKCSRDTQVENQALHDYVDGLTITMNVIQPHGRKESKEQAAEIMQDVTLSSQGGQPSSAIH
Ga0314732_122176Ga0314732_1221761F102419QVQSAINEGRLVLSEMQIDKAHFPVHTLELNNPKVLIRPEQAEGAKGKNVVIGDPRPMDTSDKILAREVIKEKTDDGKDTLKIIVRNPRLGGQGSSPPENWSADQARPVRLVSPTDPTGPTGQTGSSSRSDRSGDRPRTFKPKHLEVGTWKTNEVKV
Ga0314732_123509Ga0314732_1235091F016911RFMAIAHYGYLVLKMPYPAGVLTVWGDRTAAVAAVEKLHALMAEATRFEEDPSTSRARAPAKAPKVLPSDPDNVPVKTVQIGVDSSRTTCIAGNLEEK
Ga0314732_123945Ga0314732_1239451F012546SLVLSCNSRSFVIKLDYDYRYLLEVYSELSDIYFVIWLRYHSMFALHDRPVLAMVNILALEL
Ga0314732_126503Ga0314732_1265031F084981SGAAHLAPDAQQCPYGTLRARPLGPRLYELLLLRTCEAVVAGDLLASSVQCDSRSLAKSLLLGTSAECGLTDVESVTRVCSAPETARTALPLNLILQLYLTDLTLLLLPLSWLWWPWHL
Ga0314732_126965Ga0314732_1269651F012944PKSSTSEGSNKVARSHDRGVMLLPDLAKEIELKLENNSSSIQTQIDLKPKSTRIGTLIAQHVFGLRNSSSVYKQMIRSSYENSSDRLLHVENQSATASREAPVFDVYPDPIESSQDSLDFITNALIKMQLKSCRDHTLAELLDNLREVASIDDLPFQHGAPLVTERETGSGRTVLADYGSDLES
Ga0314732_127184Ga0314732_1271841F041531REVRHLRRGGAVTDYPGMLHMAKAVTVSPRFVDAYQRCRIGRRWGFLPSQLGHTTYPAYKRERGLRVRRTYTPLPEPSDGCVFPEEMVRITGRDPTPVEQEALRAVQWRHGRWGGSKRDVFSPSCGKVRRSYHYRARPGFSYLSFVGPGRTKLSPLWEKGADWGLVPADFRSEEEERGLAKLE
Ga0314732_127768Ga0314732_1277681F075544LRPLHIGDDVLGHPNGVVPTPFLIPNLVSNHLAICLLLDYIGGAIVFVPPVELGVDERTLNFEFLF
Ga0314732_128466Ga0314732_1284661F053748MRCCDQGAHIRERLTANRSDLTLQGGPNQHGTYLPRRTIRTNHSPPRLELQEPAQRHMVSRAQ
Ga0314732_128802Ga0314732_1288021F078111MGWMNSIPWVDCHALEARTIVVEQGGWEIAILSQLRTELMCHLA
Ga0314732_129490Ga0314732_1294901F106076AQVTVIPDDKSNTVLSKGNSKGFIASIPIGGQIAPNSTVGDKALWKNAQKIAKKNKASETINKATPIFNPLXTAAVXLPRYVPSEITSRHQNDIDNTTEINANKTKTLELLKPCIVNTPLVVKVNKEIQVYNGQGDGETKXKGWCXNILLLKASKFILFIILR
Ga0314732_129745Ga0314732_1297451F040414SVDLVAASDGLDLRVSEAILDALFFTSVKIPRTLRAFAKSSLRPWFKGSRGEAVRVNHGQMQGAYLSFPLLCLHSYCAATWAARFDREARFLVNGDDTVISANRDILVQDYPSGYRLNMDKTIRAGNTVEVNSTVFLWSKGKWREVRHLRRGGAVTDFPGMLHMAKAVTVSPR
Ga0314732_131895Ga0314732_1318952F042712MEYLLDESGRQKFLQLLADRPALELVEASQALLHRLGVGSDIKGMLGDLPWYARRVRGAPREDVCVGAEKVDEHHFLFAV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.