Basic Information | |
---|---|
Family ID | F093512 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 106 |
Average Sequence Length | 46 residues |
Representative Sequence | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Number of Associated Samples | 87 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 83.96 % |
% of genes near scaffold ends (potentially truncated) | 18.87 % |
% of genes from short scaffolds (< 2000 bps) | 100.00 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (58.491 % of family members) |
Environment Ontology (ENVO) | Unclassified (83.019 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (49.057 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 19.57% Coil/Unstructured: 80.43% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 58.49% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 16.04% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 5.66% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.77% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.83% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.89% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300009971 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_174 metaG | Host-Associated | Open in IMG/M |
3300009972 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG | Host-Associated | Open in IMG/M |
3300009973 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009976 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG | Host-Associated | Open in IMG/M |
3300009977 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_91 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Host-Associated | Open in IMG/M |
3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Host-Associated | Open in IMG/M |
3300009989 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300009992 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015273 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017694 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300028061 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028063 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028144 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028150 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028527 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300032464 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032550 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032589 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032590 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032592 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032758 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032790 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032812 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032824 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032825 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032826 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032889 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032917 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033531 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033533 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0070690_1013743471 | 3300005330 | Switchgrass Rhizosphere | SKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0070670_1017532831 | 3300005331 | Switchgrass Rhizosphere | VMMMSKDDWKAVYTKDDDLKLTKAGGNKIRRTMTLLFFSSGMLNILLIE* |
Ga0070671_1002811791 | 3300005355 | Switchgrass Rhizosphere | MMSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0070688_1002865611 | 3300005365 | Switchgrass Rhizosphere | MMSKDDWKAVYTKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0070667_1011892311 | 3300005367 | Switchgrass Rhizosphere | MSKDDWKAVYAKDDDLKLTKARGNKIRRTTTPPIFSSWMLDILLIE* |
Ga0070686_1018728541 | 3300005544 | Switchgrass Rhizosphere | MSKDDWKAVYTKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0070665_1024173741 | 3300005548 | Switchgrass Rhizosphere | TKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0068861_1020038431 | 3300005719 | Switchgrass Rhizosphere | MSKDDCKAVNAKDDDLKLTKAGGNNIRRTTTPPIFSSGMLDILLIE* |
Ga0068863_1015184331 | 3300005841 | Switchgrass Rhizosphere | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0079221_113773462 | 3300006804 | Agricultural Soil | MRTRQQETMEKVMTMSKDDREALCMKDDDLKMTKVGGNKIIRTMTLPIFSNGMLDILLVE |
Ga0105127_106581 | 3300009971 | Switchgrass Associated | MSKDDWKAVNAKDDDLKLTKAEGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0105137_1015272 | 3300009972 | Switchgrass Associated | MMTSKDDWKVVYTKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0105136_1138111 | 3300009973 | Switchgrass Associated | MMMLKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0105129_1038912 | 3300009975 | Switchgrass Associated | MMMSKDDWKAVYAKDDDLKLTKAGGNKITRTTTPPIFSSGMLDILLIE* |
Ga0105129_1193443 | 3300009975 | Switchgrass Associated | MMMSKDDLKAMYAKDDDLKLTKTRGNEIRRTTTPPIFSSGMLDILLIE* |
Ga0105128_1068122 | 3300009976 | Switchgrass Associated | MTMSKDDWKAVYAKDDDLKLAKAGGNKIRRIIIRPIFYSGLLDKHLVE* |
Ga0105141_1137491 | 3300009977 | Switchgrass Associated | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIISSGMLDILLIE* |
Ga0105141_1264602 | 3300009977 | Switchgrass Associated | WKAVYAKDDNLKLTKSGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0105135_1050551 | 3300009980 | Switchgrass Associated | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTKTPPIFSSGMLDILLIK* |
Ga0105135_1274921 | 3300009980 | Switchgrass Associated | MMMSKDDWKAVYAKDDDLKLTKAGGNKIIRTTTPPTFSSGMLDILLIE* |
Ga0105133_1209671 | 3300009981 | Switchgrass Associated | MMMSKDDWKAVYTKDDDLKLTKAGGNKIRRTTTPPNFSSEMLDILLIE* |
Ga0105029_1043181 | 3300009984 | Switchgrass Rhizosphere | MSKDDWKAVYAKDDDLKFTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0105029_1212512 | 3300009984 | Switchgrass Rhizosphere | MTMSKDDWKAVYAKDDDLKLTQAEGKKIRRTTTPPIFSSEMLDILLIE* |
Ga0105030_1059221 | 3300009987 | Switchgrass Rhizosphere | MSKDDWKAVYAKDDDLKLTKPGGNKIRRTTMPPIFSSGMLDILLIE* |
Ga0105131_1023442 | 3300009989 | Switchgrass Associated | WKAECTKDDDLKLTKAGGNKIRRIMTPPIFSSGMLDILLVE* |
Ga0105132_1137342 | 3300009990 | Switchgrass Associated | MMMSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0105132_1304441 | 3300009990 | Switchgrass Associated | MSNDDWKAVYTKDDDLKLIKVGGNKIRRTTTPHIFSSEMLDILLIE* |
Ga0105132_1349921 | 3300009990 | Switchgrass Associated | MSNDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0105120_10156641 | 3300009992 | Switchgrass Associated | MSKDDWKAVYAKDDDLKLTKARGNKIRRTTTPTIFSIGMLDVLLIE* |
Ga0105120_10474151 | 3300009992 | Switchgrass Associated | MMMSKDDWKAVYTKDDYLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0134125_114140381 | 3300010371 | Terrestrial Soil | MMMSKDDWKAVYTKDDDLKLIKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0134125_119908612 | 3300010371 | Terrestrial Soil | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0134122_124831931 | 3300010400 | Terrestrial Soil | MSKDDWKAVYAKDDDLKLTKTGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0134121_116981522 | 3300010401 | Terrestrial Soil | MIGMAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0163162_133587792 | 3300013306 | Switchgrass Rhizosphere | MSKDDWMAIHAKDDDLKLTKAGGNKIRRTTTPPIFSSGILDILLIK* |
Ga0163163_125799342 | 3300014325 | Switchgrass Rhizosphere | MSKDDWKAVYAKDDDLKLTKAGVNKIRRTTTPPIFSSGMLDILLIE* |
Ga0157380_135529261 | 3300014326 | Switchgrass Rhizosphere | VYAKDDDLKLTKAVGKKIRRTTTPPIFSSEMLDILLIE* |
Ga0182183_10597701 | 3300015270 | Switchgrass Phyllosphere | MMMSKDDWKAVYAKDNDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0182102_10156031 | 3300015273 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGNKIR*IMTPPIFSSEMLDILL |
Ga0182100_10341431 | 3300015280 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKVGGNKIRRTTTPSIFSSGMLDILLIE* |
Ga0182101_10851252 | 3300015284 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTAPPIFSSEMLDILLIE* |
Ga0182105_10711822 | 3300015290 | Switchgrass Phyllosphere | MMMSKDDWKAVYTKDNDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0182105_10838092 | 3300015290 | Switchgrass Phyllosphere | VYTKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0182104_10423171 | 3300015297 | Switchgrass Phyllosphere | MSKDDWKAGYAKDDDLKLTKAGDNKIRRIMTPPIFSSGMLDILLIE* |
Ga0182162_11009111 | 3300015310 | Switchgrass Phyllosphere | MMMSKDDGKAVYTKDDDLKLTEAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0182182_10551351 | 3300015311 | Switchgrass Phyllosphere | MMMSKDDWKAVYAKDDDLKLTKAGGNKIKRTTTPPIFSSKMLDILLIE* |
Ga0182165_11243421 | 3300015320 | Switchgrass Phyllosphere | MSKDDWKAVYIKDDDLKLTKAGGNKIR*TTTPPIFSNGMLDLLLIE |
Ga0182165_11319851 | 3300015320 | Switchgrass Phyllosphere | MSKDDWKDVYAKDGDLKLTKAGDNKIRRIMTPPIFSSGMLDILLVE* |
Ga0182134_10814851 | 3300015324 | Switchgrass Phyllosphere | MMMSKDDWKAVYTKDYDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE* |
Ga0182148_10939012 | 3300015325 | Switchgrass Phyllosphere | MMMSKDNWKAVYTKDDDLKLTKAGGNKIRRSTTPPIFSSEMLDILLIE* |
Ga0182166_11427831 | 3300015326 | Switchgrass Phyllosphere | MMMSKDDWKAVYTKDDDLKLNKDGGNKIRRTMTPPIFSSGILDILLIE* |
Ga0182152_11461522 | 3300015330 | Switchgrass Phyllosphere | SKDDWKAVYAKDDDLKLTKAGGNKIRRTAAPPIFSSGMLDILLIE* |
Ga0182117_11314262 | 3300015332 | Switchgrass Phyllosphere | MTMSKDDWKTVNAKDDDLKFTKTGGNKIRRTTTPPIFSNEMLDILLIE* |
Ga0182147_10747361 | 3300015333 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTIPPIFSSGMLDILLIE* |
Ga0182150_11216231 | 3300015336 | Switchgrass Phyllosphere | MMMSKDDWKAVYAKDDDLKLTKAVGNKIRRTTTPPIFSSEMLDILLIE* |
Ga0182150_11455062 | 3300015336 | Switchgrass Phyllosphere | MSKDDLKAMYAKDDDLKLTKDGGNNIRRTTTPPIFSSGMLDIFLIE* |
Ga0182151_11439721 | 3300015337 | Switchgrass Phyllosphere | MTMSKDDWKAVYAKDDDLKWTKAGGNKIRRTTIPPIFSSGMLDILQIE* |
Ga0182185_12269821 | 3300015349 | Switchgrass Phyllosphere | MMMSKDDWKAVYIKDDDLKLTKAGGNKIRRTTTPPIFSRGMLDILLIE* |
Ga0182197_11268191 | 3300017408 | Switchgrass Phyllosphere | MMSKDDWKAVYTKDDDLKLTKAGGNKIRRNTTPPIFSSGMLDILLIE |
Ga0182213_11552222 | 3300017421 | Switchgrass Phyllosphere | MMSKDDWKAVYAKDDDLKLTKAGGNKIIRTTIPPIFSIGMLDILLIE |
Ga0182194_10939431 | 3300017435 | Switchgrass Phyllosphere | MMMSKDDWKAVYTKDDDLKIDQAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0182215_11563393 | 3300017447 | Switchgrass Phyllosphere | MMSKDDWKAVYAKDDDLKLTKAGGNKIIRTTTPPIFSSGMLDILLIK |
Ga0182211_11624231 | 3300017694 | Switchgrass Phyllosphere | MMSKDDWKAVYTKDDELKLTKSGDNKIKRTTTPPIFSSEMLDILLIE |
Ga0163161_119885881 | 3300017792 | Switchgrass Rhizosphere | MSKDDWKAVNVKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0268314_10419871 | 3300028061 | Phyllosphere | MSKDDWKAVYTKDDDLKLIKAGGNKIRRTTTPPIFSSEMLDILLIE |
Ga0268314_10479032 | 3300028061 | Phyllosphere | MSEDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0268350_10671271 | 3300028063 | Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLVECNQRKRPL |
Ga0268345_10230681 | 3300028144 | Phyllosphere | MMSKDDWKAVYTKDDNLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0268343_10058551 | 3300028150 | Phyllosphere | MMMSKDDWKALYTKDDDFKLTKAGGNKIRRTMTPPIFSSGMLDILLIE |
Ga0268335_10070282 | 3300028527 | Phyllosphere | KDDDLKLTKAGGNKIRRIMTPPIFSSGMLNILLVE |
Ga0214492_10399601 | 3300032464 | Switchgrass Phyllosphere | MMSKDDWKAVYTKDDYLKLTKAGGTKIRRTTIPPIFSSGMLDILLIE |
Ga0214493_11679721 | 3300032465 | Switchgrass Phyllosphere | MSTDDWKAVYANDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0214503_10704221 | 3300032466 | Switchgrass Phyllosphere | MMMSKDDWKAVYAKDDDLKLTKAVGNKIRRTTTPPIFSSEMLDIVLIE |
Ga0214503_10918161 | 3300032466 | Switchgrass Phyllosphere | MAMSKDDWKAVYAKDDDLKLTKAGGKKIRRTTTPPIFSSGMLDILLIE |
Ga0214488_10150691 | 3300032467 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGKKIRRTTTPPIFSSGMLDILLIE |
Ga0214491_10751881 | 3300032469 | Switchgrass Phyllosphere | MMSKDDWKAVYAKDDDLKLTKAVGNKIRRTTTPPIFSSEMLDIVLIE |
Ga0214491_11063001 | 3300032469 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGKKIIKTTTPPIFSSGMLDILLIE |
Ga0214502_10874262 | 3300032514 | Switchgrass Phyllosphere | MSMDDWKAVYAKDEDLKLTKAEGNKIRRTTTPPIISNGMLDILLIE |
Ga0321340_10503731 | 3300032550 | Switchgrass Phyllosphere | MMSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE |
Ga0214500_12026672 | 3300032589 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDIFLIE |
Ga0214489_10495151 | 3300032590 | Switchgrass Phyllosphere | MMSKDDWKAVYAKDDDLKLTKVGSNKIRRTTAPPIFSSEMLDILLIE |
Ga0214489_10737541 | 3300032590 | Switchgrass Phyllosphere | MMKSKDDWKAVYAKDDDLKLTKAGGNEIIRTTTPPIFSSGMLDILLIE |
Ga0214504_10865582 | 3300032592 | Switchgrass Phyllosphere | MMSNDDWKAVYAKDDDLKLTKAVGNKIRRTTTPPIFSSEMLDIVLIE |
Ga0214501_11190031 | 3300032625 | Switchgrass Phyllosphere | AECTKDDDLKLTKAGGNKIRRIMTPPIFSSGMLDILLVE |
Ga0214497_10275171 | 3300032689 | Switchgrass Phyllosphere | MSKDDWKAVNAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0214497_11136621 | 3300032689 | Switchgrass Phyllosphere | KDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0214485_11006531 | 3300032698 | Switchgrass Phyllosphere | MMSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSEKLDILLIE |
Ga0214485_11115402 | 3300032698 | Switchgrass Phyllosphere | MSKDDSKAVYTKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0214494_10603041 | 3300032699 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGNEIIRTTTPPIFSSGMLDILLIE |
Ga0314746_10744392 | 3300032758 | Switchgrass Phyllosphere | MSMDDWKAVYAKDEDLKLTKAEGNKIRRTTTPPIFSSGMLDILLIE |
Ga0314731_10803371 | 3300032790 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGKKIRRTTTPPIFSSGMLDIFLIE |
Ga0314745_10968752 | 3300032812 | Switchgrass Phyllosphere | MKKVMMKSKDDWKAVYAKDDDLKLTKAGGNEIIRTTTPPIFSSGMVDILLIE |
Ga0314723_11060621 | 3300032823 | Switchgrass Phyllosphere | MMSKDDWKAVYAKDDDLKLTKAVGNKIRRTTTPPIFSSEKLDILLIE |
Ga0314735_11095311 | 3300032824 | Switchgrass Phyllosphere | MDDWKAVYAKDEDLKLTKAEGNKIRRTTTPPIISNGMLDILLIE |
Ga0314724_1260531 | 3300032825 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPSIFSSGMLDILLIE |
Ga0314732_1138722 | 3300032826 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGLLDILLIE |
Ga0314751_11300332 | 3300032889 | Switchgrass Phyllosphere | MMSKDDWKAVYTKDDDLKLTKAGDNKIRRTTTPPIFSSGMLDILLIE |
Ga0314734_10665561 | 3300032916 | Switchgrass Phyllosphere | DDDWKAVYTKDDDLKLTKAGGNKIRRTTTPPIFSSEMLDILLIE |
Ga0314721_1336771 | 3300032917 | Switchgrass Phyllosphere | MSKDDWKAVYTKDDDLKLTKAGGNKIIRIMTPPIFSSGMLDILLVE |
Ga0314758_11697041 | 3300033525 | Switchgrass Phyllosphere | MSKDDWKAIYAKDDDLKLTKAGGNKIRRTTTPPIFSSEKLDILLIE |
Ga0314760_11376051 | 3300033530 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAVGNKIRRTTTPPIFSSEMLDIVLIE |
Ga0314756_10812681 | 3300033531 | Switchgrass Phyllosphere | MMSNDDWKAVYAKDDDLKLTKAVGNKIRRTTTPPIFSSEMLDILLIE |
Ga0314770_11835091 | 3300033533 | Switchgrass Phyllosphere | MMSKDDWKAVYAKDDDLKLTKAGGNKIRRTTTPPIFSSGMLDILLIE |
Ga0314770_12609352 | 3300033533 | Switchgrass Phyllosphere | SKDDWKAVYAKDDDLKLTKAGGKKIRRTTTPPIFSSGMLDLLLIE |
Ga0314759_11328861 | 3300033535 | Switchgrass Phyllosphere | MSKDDWKAVYTKDDDLKLTKAGDNKIRRTTTPPIFSSGMLDILLIE |
Ga0314759_11517671 | 3300033535 | Switchgrass Phyllosphere | MSKDDWKAVYAKDDDLKLTKAGGKKIRRTTTPPIFSSGMLDILLIEXCYQG |
⦗Top⦘ |