| Basic Information | |
|---|---|
| Family ID | F096266 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIDARLVFLLLTALLLAILTAIAVATLRKKRKQKLEEPKYRMLKDD |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.05 % |
| % of genes near scaffold ends (potentially truncated) | 13.33 % |
| % of genes from short scaffolds (< 2000 bps) | 74.29 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.048 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment (13.333 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (25.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.41% β-sheet: 0.00% Coil/Unstructured: 44.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF13442 | Cytochrome_CBB3 | 63.81 |
| PF00115 | COX1 | 10.48 |
| PF00034 | Cytochrom_C | 4.76 |
| PF14715 | FixP_N | 2.86 |
| PF02433 | FixO | 2.86 |
| PF13690 | CheX | 2.86 |
| PF01522 | Polysacc_deac_1 | 0.95 |
| PF03717 | PBP_dimer | 0.95 |
| PF00958 | GMP_synt_C | 0.95 |
| PF00152 | tRNA-synt_2 | 0.95 |
| PF01594 | AI-2E_transport | 0.95 |
| PF04357 | TamB | 0.95 |
| PF03449 | GreA_GreB_N | 0.95 |
| PF02954 | HTH_8 | 0.95 |
| PF03692 | CxxCxxCC | 0.95 |
| PF05036 | SPOR | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG2993 | Cbb3-type cytochrome oxidase, cytochrome c subunit FixO | Energy production and conversion [C] | 2.86 |
| COG0017 | Aspartyl/asparaginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0173 | Aspartyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.95 |
| COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.95 |
| COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| COG0768 | Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2) | Cell cycle control, cell division, chromosome partitioning [D] | 0.95 |
| COG0782 | Transcription elongation factor, GreA/GreB family | Transcription [K] | 0.95 |
| COG1190 | Lysyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG2269 | Elongation factor P--beta-lysine ligase (EF-P beta-lysylation pathway) | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.05 % |
| Unclassified | root | N/A | 0.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000558|Draft_11565769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 1865 | Open in IMG/M |
| 3300001373|YBMDRAFT_10130336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 687 | Open in IMG/M |
| 3300002988|FeGlu_10004106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 5925 | Open in IMG/M |
| 3300002988|FeGlu_10014129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 649 | Open in IMG/M |
| 3300002988|FeGlu_10048232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 4424 | Open in IMG/M |
| 3300003471|FeGluNO3_10006664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 8458 | Open in IMG/M |
| 3300003473|FeGluAir_10014839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1478 | Open in IMG/M |
| 3300003473|FeGluAir_10042386 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 2131 | Open in IMG/M |
| 3300003473|FeGluAir_10045255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 2053 | Open in IMG/M |
| 3300003473|FeGluAir_10048025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 2416 | Open in IMG/M |
| 3300003473|FeGluAir_10069205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 2588 | Open in IMG/M |
| 3300003473|FeGluAir_10102479 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300003473|FeGluAir_10211490 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 2406 | Open in IMG/M |
| 3300003473|FeGluAir_10251750 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300003473|FeGluAir_10268769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 867 | Open in IMG/M |
| 3300003473|FeGluAir_10489991 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300003887|Ga0062443_1000335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 850724 | Open in IMG/M |
| 3300003888|Ga0062442_1035992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 626 | Open in IMG/M |
| 3300004154|Ga0066603_10297131 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300004155|Ga0066600_10210635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 843 | Open in IMG/M |
| 3300004282|Ga0066599_100031664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1953 | Open in IMG/M |
| 3300004282|Ga0066599_100074391 | All Organisms → cellular organisms → Bacteria | 1501 | Open in IMG/M |
| 3300004693|Ga0065167_1001541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 4530 | Open in IMG/M |
| 3300004808|Ga0062381_10171403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 736 | Open in IMG/M |
| 3300005831|Ga0074471_10358142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 872 | Open in IMG/M |
| 3300005831|Ga0074471_10852125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 22078 | Open in IMG/M |
| 3300006033|Ga0075012_10343655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1002 | Open in IMG/M |
| 3300008988|Ga0116025_10019727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 987 | Open in IMG/M |
| 3300009179|Ga0115028_11445790 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 581 | Open in IMG/M |
| 3300009609|Ga0105347_1128120 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 977 | Open in IMG/M |
| 3300009609|Ga0105347_1313147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 662 | Open in IMG/M |
| 3300009610|Ga0105340_1168903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 909 | Open in IMG/M |
| 3300010397|Ga0134124_10171010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 1953 | Open in IMG/M |
| 3300010397|Ga0134124_11253034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 763 | Open in IMG/M |
| 3300011413|Ga0137333_1019320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1505 | Open in IMG/M |
| 3300011419|Ga0137446_1058614 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 872 | Open in IMG/M |
| 3300011434|Ga0137464_1171980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 659 | Open in IMG/M |
| 3300012040|Ga0137461_1241082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 527 | Open in IMG/M |
| 3300012206|Ga0137380_10145118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 2164 | Open in IMG/M |
| 3300012349|Ga0137387_10551693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300012356|Ga0137371_10476435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300012668|Ga0157216_10094689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae | 1456 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10001184 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 38966 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10001679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 31510 | Open in IMG/M |
| 3300013315|Ga0173609_10712994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1944 | Open in IMG/M |
| 3300013315|Ga0173609_10718734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 4996 | Open in IMG/M |
| 3300014498|Ga0182019_10152754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1464 | Open in IMG/M |
| 3300014498|Ga0182019_10508795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 835 | Open in IMG/M |
| 3300014502|Ga0182021_10337507 | All Organisms → cellular organisms → Bacteria | 1780 | Open in IMG/M |
| 3300014502|Ga0182021_12750843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 591 | Open in IMG/M |
| 3300014874|Ga0180084_1136041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 515 | Open in IMG/M |
| 3300014879|Ga0180062_1027176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1188 | Open in IMG/M |
| 3300015192|Ga0167646_1043359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1056 | Open in IMG/M |
| 3300018059|Ga0184615_10394188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 760 | Open in IMG/M |
| 3300018083|Ga0184628_10106249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1446 | Open in IMG/M |
| 3300019785|Ga0182022_1013760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1783 | Open in IMG/M |
| 3300020048|Ga0207193_1426688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 882 | Open in IMG/M |
| 3300020164|Ga0194037_1005792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 6965 | Open in IMG/M |
| 3300021069|Ga0194062_1065050 | Not Available | 1146 | Open in IMG/M |
| 3300021074|Ga0194044_10331671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 573 | Open in IMG/M |
| 3300021354|Ga0194047_10027206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 2748 | Open in IMG/M |
| 3300021354|Ga0194047_10077987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1444 | Open in IMG/M |
| 3300021473|Ga0194043_1253452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 570 | Open in IMG/M |
| 3300021600|Ga0194059_1000007 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 161058 | Open in IMG/M |
| 3300021600|Ga0194059_1009934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 3496 | Open in IMG/M |
| 3300021600|Ga0194059_1018429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 2463 | Open in IMG/M |
| 3300021600|Ga0194059_1051287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1352 | Open in IMG/M |
| 3300021600|Ga0194059_1161967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 680 | Open in IMG/M |
| 3300021601|Ga0194061_1051909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1393 | Open in IMG/M |
| 3300021602|Ga0194060_10020172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 4148 | Open in IMG/M |
| 3300021602|Ga0194060_10041335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 2738 | Open in IMG/M |
| 3300024232|Ga0247664_1021303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1508 | Open in IMG/M |
| 3300025013|Ga0209317_1009150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 4665 | Open in IMG/M |
| 3300025154|Ga0209417_1021122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 4269 | Open in IMG/M |
| 3300025309|Ga0209212_1389417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 615 | Open in IMG/M |
| 3300025436|Ga0208103_1003782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 2625 | Open in IMG/M |
| 3300027735|Ga0209261_10160835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 598 | Open in IMG/M |
| 3300027840|Ga0209683_10046508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1893 | Open in IMG/M |
| 3300027841|Ga0209262_10338546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 733 | Open in IMG/M |
| 3300027851|Ga0209066_10560122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 578 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1027948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 4043 | Open in IMG/M |
| 3300030000|Ga0311337_11759070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 544 | Open in IMG/M |
| 3300030002|Ga0311350_11554735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 587 | Open in IMG/M |
| 3300030019|Ga0311348_10627224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 802 | Open in IMG/M |
| 3300030019|Ga0311348_10875853 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300030294|Ga0311349_10538232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1105 | Open in IMG/M |
| 3300030294|Ga0311349_10617425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1025 | Open in IMG/M |
| 3300031232|Ga0302323_101879826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 679 | Open in IMG/M |
| 3300031232|Ga0302323_102105677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 642 | Open in IMG/M |
| 3300031232|Ga0302323_102843360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 553 | Open in IMG/M |
| 3300031232|Ga0302323_103429918 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031726|Ga0302321_101232570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 858 | Open in IMG/M |
| 3300031902|Ga0302322_100897589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 1063 | Open in IMG/M |
| 3300033418|Ga0316625_100055133 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1960 | Open in IMG/M |
| 3300033418|Ga0316625_100602768 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300033418|Ga0316625_100638315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Citrifermentans → Citrifermentans bemidjiense | 878 | Open in IMG/M |
| 3300033418|Ga0316625_101277652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 678 | Open in IMG/M |
| 3300033418|Ga0316625_101992129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 571 | Open in IMG/M |
| 3300033483|Ga0316629_10368757 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300033521|Ga0316616_102655547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 673 | Open in IMG/M |
| 3300033521|Ga0316616_103266430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 611 | Open in IMG/M |
| 3300034056|Ga0373893_034531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter | 663 | Open in IMG/M |
| 3300034130|Ga0370494_161245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 577 | Open in IMG/M |
| 3300034169|Ga0370480_0000949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Pelobacter → Pelobacter propionicus | 11901 | Open in IMG/M |
| 3300034191|Ga0373909_0156352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 708 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 13.33% |
| Wetland Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Wetland Sediment | 13.33% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 11.43% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 8.57% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 7.62% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 4.76% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 4.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.86% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.86% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 2.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.86% |
| Anaerobic Enrichment Culture | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.90% |
| Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 1.90% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.90% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.90% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.90% |
| Sediment | Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment | 1.90% |
| Sediment Slurry | Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry | 1.90% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.95% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.95% |
| Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.95% |
| Oil Sands | Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands | 0.95% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
| 3300001373 | YB-Mouth-sed | Environmental | Open in IMG/M |
| 3300002988 | Fe-reducing enrichment culture from wetland sample 1 | Environmental | Open in IMG/M |
| 3300003471 | Fe-reducing enrichment culture from wetland. Sample 5 with periodic nitrate additions. | Environmental | Open in IMG/M |
| 3300003473 | Fe-reducing enrichment culture from wetland. Sample 3 with anaerobic and aerobic cycling. | Environmental | Open in IMG/M |
| 3300003887 | Freshwater pond sediment microbial communities from Middleton WI, HM 5/6 enriched by Humin under anaerobic conditions -HM Sample 3 | Environmental | Open in IMG/M |
| 3300003888 | Freshwater pond sediment microbial communities from Midddleton WI, HM 3/4 enriched by Glucose under anaerobic conditions -HM Sample 2 | Environmental | Open in IMG/M |
| 3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
| 3300004155 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 | Environmental | Open in IMG/M |
| 3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
| 3300004693 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (version 2) | Environmental | Open in IMG/M |
| 3300004808 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh | Environmental | Open in IMG/M |
| 3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
| 3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
| 3300008988 | Combined Assembly of De NOVO T65 T0 (live) Oil Sands Gp0125710, Gp0125712, Gp0125662 | Environmental | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012668 | Arctic soils microbial communities. Combined Assembly of 23 SPs | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013315 | Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1B | Engineered | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
| 3300014879 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10D | Environmental | Open in IMG/M |
| 3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300019785 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020164 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m | Environmental | Open in IMG/M |
| 3300021069 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-25m | Environmental | Open in IMG/M |
| 3300021074 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17m | Environmental | Open in IMG/M |
| 3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
| 3300021473 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15m | Environmental | Open in IMG/M |
| 3300021600 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L626-11m | Environmental | Open in IMG/M |
| 3300021601 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025013 | Soil microbial communities from Rifle, Colorado, USA - Groundwater B2 | Environmental | Open in IMG/M |
| 3300025154 | Soil microbial communities from Rifle, Colorado, USA - Groundwater F2 | Environmental | Open in IMG/M |
| 3300025309 | Soil microbial communities from Rifle, Colorado, USA - Groundwater C2 | Environmental | Open in IMG/M |
| 3300025436 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes) | Environmental | Open in IMG/M |
| 3300027735 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027841 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027851 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes) | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034056 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.3 | Engineered | Open in IMG/M |
| 3300034130 | Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16 | Environmental | Open in IMG/M |
| 3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
| 3300034191 | Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B4A4.1 | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_115657692 | 3300000558 | Hydrocarbon Resource Environments | MIDTRIVFLLLTALLLAILTAIAVATLRKNRKQKLEEPKYRMLEDD* |
| YBMDRAFT_101303362 | 3300001373 | Marine Estuarine | MINARLVFLVLTAVLLFLLVVITVATLRRKRKHKLEEPKYRM |
| FeGlu_100041064 | 3300002988 | Wetland Sediment | MIDARIVFLLLTALLLSILVAIAVATFRKNRKQKLEDPKYRMLKDD* |
| FeGlu_100141292 | 3300002988 | Wetland Sediment | MIEARIAFLLLTAIMLAILTAIAVATLRKKRKTKLEEPKYRMLNDD* |
| FeGlu_100482324 | 3300002988 | Wetland Sediment | MIDARLVFLLLTALLLLILVAIAVATFRKKRKQKLEDPKYRMLEDD* |
| FeGluNO3_100066642 | 3300003471 | Wetland Sediment | MIDARLIFLLLTTLLLAILSGIAIVTLRKNRKQKLEEPKYRMLKDD* |
| FeGluAir_100148393 | 3300003473 | Wetland Sediment | MIDARIVFLLLTALLLSILVAIAVATFRKNRRQKLEDPKYRMLKDD* |
| FeGluAir_100423863 | 3300003473 | Wetland Sediment | MIDARLVFLLLTTLLLAILSVIAVVTLRKNRRQKLEEPKYRMLKDD* |
| FeGluAir_100452552 | 3300003473 | Wetland Sediment | MIDARLVFLLLTALLLLILVAIAVATFRKNRKQKLEDPKYRMLKDD* |
| FeGluAir_100480253 | 3300003473 | Wetland Sediment | MIDARIVFLLLTALMLAILTAIAVATLRKKRKQKLEEPKYRMLKDD* |
| FeGluAir_100692054 | 3300003473 | Wetland Sediment | MTMDARFVFLLLTGFLLAVLVAITVVTLSKRRKQKLEEPKHRMLEDD* |
| FeGluAir_101024792 | 3300003473 | Wetland Sediment | MANRMIEARIVFLLLTALMLAILTAIAVTTLRKKSKQKLEEPKYRMLKDD* |
| FeGluAir_102114902 | 3300003473 | Wetland Sediment | MMDARIVFLLLTGFLLAILIAIAVVTLNKSRKQKLEEPKHRMLEDD* |
| FeGluAir_102517501 | 3300003473 | Wetland Sediment | MIDARFVFLLLTALLLAILAAIAVVTLRKSRKQALEEPKYRMLKDD* |
| FeGluAir_102687692 | 3300003473 | Wetland Sediment | IFLLITAILLAILTVIAVVTLRKKRRQKLEEPKYRMLEDD* |
| FeGluAir_104899911 | 3300003473 | Wetland Sediment | MIDPRIVFLLLTALMLAILTVIAVATLRKHRKKKLEEPKYRMLEDD* |
| Ga0062443_1000335285 | 3300003887 | Anaerobic Enrichment Culture | MIDARVVFLLMTSLMLAILVGIGIATYRKGRKQKMEEPKYRMLDED* |
| Ga0062442_10359921 | 3300003888 | Anaerobic Enrichment Culture | MIDARLIFLLLTTLLLAILSAIAVVTLRKNRKHKLEEPKYRMLKDD* |
| Ga0066603_102971312 | 3300004154 | Freshwater | MIDARLVFLLLTALMLAVLVAIAVATLRKKRRQKLEEPKYRMLKDD* |
| Ga0066600_102106352 | 3300004155 | Freshwater | MIDARLVFLLLTALMLAILVAIAVATLRKKRKQKLEEPKYRMLKDD* |
| Ga0066599_1000316645 | 3300004282 | Freshwater | MIEARLVFLLLTALMLVILVAIAVATLRKNRKQKLEEPKYRMLKDD* |
| Ga0066599_1000743913 | 3300004282 | Freshwater | MIDARLVFLLLTALLLAILVAIAVATLRKKRKKKLEEPKYRMLKDD* |
| Ga0065167_10015415 | 3300004693 | Freshwater | MMFDARFVFLLLTGFLLAILGAITAATLNRKRKQKLEEPKHRMLEDD* |
| Ga0062381_101714032 | 3300004808 | Wetland Sediment | MIDARIVFLLLTALLLAVLTAIAVATLRKKRKQKLEEPKYRMLKDD* |
| Ga0074471_103581422 | 3300005831 | Sediment (Intertidal) | MIDARLVFLLLTALLLAILVAIAVATLRKNRKQKLEEPKYRMLDED* |
| Ga0074471_108521256 | 3300005831 | Sediment (Intertidal) | MINARLVFLVLTAVLLFLLVVITVATLRRKRKHKLEEPKYRMLKDD* |
| Ga0075012_103436552 | 3300006033 | Watersheds | MEAGYVDQEGYKMTMDARFVFLLLTGFLLAVLVAITVVTLSKRRKQKLEEPKHRMLEDD* |
| Ga0116025_100197273 | 3300008988 | Oil Sands | MMVDARFVFMLLTGVMLAALIVITIVTYSKKRKQKLEEPKHKMLEDD* |
| Ga0115028_114457901 | 3300009179 | Wetland | MIDARLVFLLLTALLLAILTAIAVATLRKKRKQKLEEPKDRMLKDD* |
| Ga0105347_11281202 | 3300009609 | Soil | MIDARLVFLLLTALLLAILTAIAVATLRKNRRQKLEEPKYRMLKDD* |
| Ga0105347_13131472 | 3300009609 | Soil | MIDARLVFLLLTALLLAILAAIAVATLRKKRKQKLEEPKYRML |
| Ga0105340_11689032 | 3300009610 | Soil | MIDARLVFLLLTALLLAILTAIAVATLRKNRKQKLEEPKYRMLKDD* |
| Ga0134124_101710103 | 3300010397 | Terrestrial Soil | MIDARLFFLLLTGLLLAILAVIAFTILRKNRKQTLEEPKYRMLKDD* |
| Ga0134124_112530342 | 3300010397 | Terrestrial Soil | MIEARIAFLLLTALLLAILIAIAVATLRKNRKQKLEDPKYRMLKDD* |
| Ga0137333_10193202 | 3300011413 | Soil | MIDARLVFLLLTALLLAILAAIAVATLRKKRKQKLEEPKYRMLKDD* |
| Ga0137446_10586142 | 3300011419 | Soil | MMDARFVFLLLTGFLLALLIAIAVVTLNKSRKQKLEEPKHRMLEDD* |
| Ga0137464_11719802 | 3300011434 | Soil | MIDARLVFLLLTTLLLAILTAIAVATLRKKRKQKLEEPKYRMLKDD* |
| Ga0137461_12410822 | 3300012040 | Soil | MIDDRLVFLLLTALLLAILTAIAVATLRKKRKQKLEEPKYRMLKDD* |
| Ga0137380_101451183 | 3300012206 | Vadose Zone Soil | MIDARFVFLLLTGLLLTILVAIAVVTLNKNRKQKLEEPKHRMLEDD* |
| Ga0137387_105516932 | 3300012349 | Vadose Zone Soil | MIDARFVFLLLTGLLLTILVAIAAVTLNKNRKQKLEEPKHRMLEDD* |
| Ga0137371_104764352 | 3300012356 | Vadose Zone Soil | MFDARFVFLLLTGLLLTILVAIAVVTLNKNRKQKLEEPKHRMLEDD* |
| Ga0157216_100946892 | 3300012668 | Glacier Forefield Soil | MIDARLIFLLMTGFLLMILVVIAAVTLNKGRKQKLEEPKHRMLEDD* |
| (restricted) Ga0172367_1000118416 | 3300013126 | Freshwater | MMLDARMVFLFLTALMLAILAAIAFVTLRKNHKKKLEEPKYRMLDDD* |
| (restricted) Ga0172367_100016798 | 3300013126 | Freshwater | MTIDYRMTFLLLTAFLLALLLAIWVNTYKRSRKKKLEEPKYRMLEDD* |
| Ga0173609_107129941 | 3300013315 | Sediment | MMIEARIVFLLLTGLMLAILAVIAVATLRNNRKQKLEEPKYRMLDDD* |
| Ga0173609_107187344 | 3300013315 | Sediment | MFDARFIFLLLTGFLLAVLVAISVTTLKKNRKRKLEEPKHRMLKDD* |
| Ga0182019_101527543 | 3300014498 | Fen | MIDARLVFLLLTALLLAILTAIAVATLRKKRQQKLEE |
| Ga0182019_105087953 | 3300014498 | Fen | ALLLAILTTIAVATLRKKRKQKLEEPKYRMLEDD* |
| Ga0182021_103375073 | 3300014502 | Fen | MIDARLVFLLLTALLLAILTAIAVATLRKKRQQKLEEPKYRMLEDD* |
| Ga0182021_127508432 | 3300014502 | Fen | MIDARIVFLLLTALLLAILTAIAVVTLRKNRKQKLEEPKYRMLKDD* |
| Ga0180084_11360412 | 3300014874 | Soil | MMDARFIFLLLTGFLLAVLIAIAVVTLNKSRKQKLEEPKHRMLEDD* |
| Ga0180062_10271762 | 3300014879 | Soil | MIDARLVFLLLTALLLAILTAIAVATLRKKRKQKLEEPKYRMLKDD* |
| Ga0167646_10433592 | 3300015192 | Glacier Forefield Soil | MTIDARFVFLLLTGFLLIILVAIAVATLNKGRKQKLEEPKHRMLEDD* |
| Ga0184615_103941882 | 3300018059 | Groundwater Sediment | MMMDGRIVFLLLTGTLLMVLVAIAAVTLNKGRKQKLEEPKHRMLEDD |
| Ga0184628_101062492 | 3300018083 | Groundwater Sediment | MIDARLVFLLLTALLLAILTAIAVATLRKKRKQKLEEPKYRMLKDD |
| Ga0182022_10137602 | 3300019785 | Fen | MIDARFVFLLLTGLLLLILASIAIITLNKGRMQKLEEPKHRMLEDD |
| Ga0207193_14266881 | 3300020048 | Freshwater Lake Sediment | MMFDARFIFLLLTGLLLAILVAIAVSTLNKKRKQKLEEPKYKMLEDD |
| Ga0194037_10057924 | 3300020164 | Anoxic Zone Freshwater | MMLDARMVFLLLTALLLAILGAIAFITLRKKRKKQLEEPKYRMLDED |
| Ga0194062_10650501 | 3300021069 | Anoxic Zone Freshwater | MFDARFVFLLLTGFLLAILVAIAVATLNKNRKEKLEEPKHRMLEDD |
| Ga0194044_103316711 | 3300021074 | Anoxic Zone Freshwater | MFDARFVFLLLTGFLLAILVAIAVATLNKNRKEKLEEPKHRMLED |
| Ga0194047_100272064 | 3300021354 | Anoxic Zone Freshwater | MIFDARFVFLLLTGFLLALLVAIAVVTYNKKQKEKLEEPKHRMLEDD |
| Ga0194047_100779874 | 3300021354 | Anoxic Zone Freshwater | LLTGFLLAILVAIAVATLNKNRKEKLEEPKHRMLEDD |
| Ga0194043_12534522 | 3300021473 | Anoxic Zone Freshwater | MMIDARFIFLLLTGLLLAILVAIAVSTLNKKRKQKLEEPKYKMLEDD |
| Ga0194059_100000754 | 3300021600 | Anoxic Zone Freshwater | MFDTRFIFLLLTGFLLTILVAIAVSTLKKNRKQKLEEPKHRMLEDD |
| Ga0194059_10099343 | 3300021600 | Anoxic Zone Freshwater | MFDTRFIFLLLTGFLLAILVAIAVSTLKRNRKQKLEEPKHRMLEDD |
| Ga0194059_10184292 | 3300021600 | Anoxic Zone Freshwater | MIEARLLFLLLTAILLALLVGIAVQTYRKKSKQKLEEPKFRMLDDD |
| Ga0194059_10512874 | 3300021600 | Anoxic Zone Freshwater | SSWANRMIEARILFLLLTALLLAILVVITVQTLRKKSKRKLEEPKFRMLDDD |
| Ga0194059_11619671 | 3300021600 | Anoxic Zone Freshwater | DNLYQAGSKMMLDARMVFLLLTALLLAILGAIAFITLRKKRKKQLEEPKYRMLDED |
| Ga0194061_10519092 | 3300021601 | Anoxic Zone Freshwater | MIEARILFLLLTALLLAILVVITVQTLRKKSKRKLEEPKFRMLDDD |
| Ga0194060_100201723 | 3300021602 | Anoxic Zone Freshwater | MIDARMLFLILTGCLLALLIAIAVATLNKKQKQKLEEPKHRMLEDD |
| Ga0194060_100413352 | 3300021602 | Anoxic Zone Freshwater | MIEARILFLILTGLLLALLIAIAVATLNKKQKQKLEEPKHRMLEDD |
| Ga0247664_10213032 | 3300024232 | Soil | MIDARLVFLLLTALLLAILAAIAVATLGKKRKQKLEEPKYRMLKDD |
| Ga0209317_10091504 | 3300025013 | Soil | MMDARVIFLLLTFVLLAILVAIAFSTLKKNRKKKLEEPKHRMLEDD |
| Ga0209417_10211226 | 3300025154 | Soil | MIDARLVFLLLTALLLLILVAIAVATFRKKRKQKLEDPKYRMLEDD |
| Ga0209212_13894172 | 3300025309 | Soil | LFLTFVLLAILVAIAFSTLKKNRKQKLEKPKHRMLEDD |
| Ga0208103_10037823 | 3300025436 | Freshwater | MMFDARFVFLLLTGFLLAILGAITAATLNRKRKQKLEEPKHRMLEDD |
| Ga0209261_101608352 | 3300027735 | Wetland Sediment | MIDARIVFLLLTALMLAILTAIAVATLRKKRKQKLEEPKYRMLKDD |
| Ga0209683_100465082 | 3300027840 | Wetland Sediment | MIDARVVFLALTALLLAILVAIAAATLRKKRKQKLEEPKYRMLQDD |
| Ga0209262_103385462 | 3300027841 | Freshwater | MIDARLVFLLLTALMLAILVAIAVATLRKKRKQKLEEPKYRMLKDD |
| Ga0209066_105601222 | 3300027851 | Watersheds | MTMDARFVFLLLTGFLLAVLVAITVVTLSKRRKQKLEEPKHRMLEDD |
| (restricted) Ga0247844_10279485 | 3300028571 | Freshwater | MMFDARFIFLILTAFLLAILVAIAVSTLKSNRKQKLENPKHRMLEDD |
| Ga0311337_117590702 | 3300030000 | Fen | MDARFVFLLLTGTLLVILAVIAAVTLSKGRKKKLEEPKHRMLEDD |
| Ga0311350_115547352 | 3300030002 | Fen | MIDARIVFLLLTALLLAVLTAIAVATLRKKRKQKLEEPKYRMLEDD |
| Ga0311348_106272241 | 3300030019 | Fen | MIDARIVFLLLTALLLAILTAIAVATLRKNRKQKLEEPKYRML |
| Ga0311348_108758532 | 3300030019 | Fen | MMDARFVFLLLTGALLMILAAIAVVTLKKGRKQKLEEPKHRMLEDD |
| Ga0311349_105382323 | 3300030294 | Fen | MIEARLLFLLLTALLLAILVAIAAATLRKNRKQKL |
| Ga0311349_106174252 | 3300030294 | Fen | MIDARLFFLVLTGLLLAILTVIALATLRKNRKQKLEEPKYRMLKDD |
| Ga0302323_1018798262 | 3300031232 | Fen | MIEARLVFLLLTALLLAILVAIAAATLRKNRKQKLEEPKYRMLKDD |
| Ga0302323_1021056772 | 3300031232 | Fen | MIDTRLVFLLLTALLLAILTAIAVATLRKKRKQKLEEPKYRMLKDD |
| Ga0302323_1028433601 | 3300031232 | Fen | MIEARLVFLLLTALLLAILSAIAVVTLRKNRKQKLEEPKYRMLKDD |
| Ga0302323_1034299181 | 3300031232 | Fen | MIDARLVFLLLTVLLLAILAAIAVATLRKDRKQKLEEPKYRMLNDD |
| Ga0302321_1012325702 | 3300031726 | Fen | MIDARIVFLLLTALLLAVLTAIAVATLRKKRKQKLEEPKYRMLKDD |
| Ga0302322_1008975892 | 3300031902 | Fen | MIEARLLFLLLTALLLAILVAIAAATLRKNRKQKLEEPKYRMLKDD |
| Ga0316625_1000551332 | 3300033418 | Soil | MIDARLVFLLLTALMLAVLVAIAVATLRKKRRQKLEEPKYRMLKDD |
| Ga0316625_1006027682 | 3300033418 | Soil | MIDARLVFLLLTALLLAILAAIAVTTLRKKRKQKLEEPKYRMLKDD |
| Ga0316625_1006383152 | 3300033418 | Soil | MIDARIVFLLLTALLLAILTAIAVATLRKKRKQKLEEPKYRMLKDD |
| Ga0316625_1012776521 | 3300033418 | Soil | DARLVFLLLTALLLAILAAIAVVTLRKNRKQKLEEPKYRMLKDD |
| Ga0316625_1019921292 | 3300033418 | Soil | MIDARLVFLLLTALLLAILVAIAVATLRKNRKQKLEEPKYRMLDED |
| Ga0316629_103687572 | 3300033483 | Soil | MIEARIVFLLLTALLLAILAAIAVSTLRKNRKQKLEEPKYRMLKDD |
| Ga0316616_1026555472 | 3300033521 | Soil | MIDARLVFLLLTALLLAILAAIAVVTLRKNRKQKLEEPKYRMLKDD |
| Ga0316616_1032664302 | 3300033521 | Soil | MIDPRIVFLLLTALMLAILTVIAVATLRKHRKKKLEEPKYRMLEDD |
| Ga0373893_034531_263_403 | 3300034056 | Sediment Slurry | MIDARIVFLALTTLLLAILVAIAVVTLRKKRKHKLEEPKYRMLQDD |
| Ga0370494_161245_350_490 | 3300034130 | Untreated Peat Soil | MIDARIIFLLLTALLLAILTAIAVVTLRKNRKQKLEEPKYRMLKDD |
| Ga0370480_0000949_754_894 | 3300034169 | Untreated Peat Soil | MIDARLVFLLLTVLLLAILTAIAVATLRKKRKQKLEEPKYRMLKDD |
| Ga0373909_0156352_46_186 | 3300034191 | Sediment Slurry | MIDARIIFLALTTLLLAILVAIAVVTLRKKRKHKLEEPKYRMLQDD |
| ⦗Top⦘ |