| Basic Information | |
|---|---|
| Family ID | F094045 |
| Family Type | Metagenome |
| Number of Sequences | 106 |
| Average Sequence Length | 52 residues |
| Representative Sequence | MKYASIFFTILFIWVAVILMALTRRNSSEIFELYLAVIASTLALFLIGFARK |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 106 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 20.75 % |
| % of genes near scaffold ends (potentially truncated) | 20.75 % |
| % of genes from short scaffolds (< 2000 bps) | 65.09 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.64 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.906 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (6.604 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.170 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.057 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.25% β-sheet: 0.00% Coil/Unstructured: 43.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.64 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 106 Family Scaffolds |
|---|---|---|
| PF03109 | ABC1 | 44.34 |
| PF13277 | YmdB | 3.77 |
| PF00702 | Hydrolase | 1.89 |
| PF01148 | CTP_transf_1 | 1.89 |
| PF00300 | His_Phos_1 | 0.94 |
| PF11611 | DUF4352 | 0.94 |
| PF01566 | Nramp | 0.94 |
| PF01168 | Ala_racemase_N | 0.94 |
| PF07963 | N_methyl | 0.94 |
| PF00293 | NUDIX | 0.94 |
| PF05157 | T2SSE_N | 0.94 |
| PF10431 | ClpB_D2-small | 0.94 |
| PF13231 | PMT_2 | 0.94 |
| PF02416 | TatA_B_E | 0.94 |
| PF01988 | VIT1 | 0.94 |
| PF01966 | HD | 0.94 |
| PF02325 | YGGT | 0.94 |
| PF09603 | Fib_succ_major | 0.94 |
| COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
|---|---|---|---|
| COG0661 | Predicted protein kinase regulating ubiquinone biosynthesis, AarF/ABC1/UbiB family | Signal transduction mechanisms [T] | 44.34 |
| COG0762 | Cytochrome b6 maturation protein CCB3/Ycf19 and related maturases, YggT family | Posttranslational modification, protein turnover, chaperones [O] | 0.94 |
| COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.94 |
| COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.94 |
| COG1826 | Twin-arginine protein secretion pathway components TatA and TatB | Intracellular trafficking, secretion, and vesicular transport [U] | 0.94 |
| COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.91 % |
| Unclassified | root | N/A | 15.09 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000476|ZC3D78_109264 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 813 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_109826053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1113 | Open in IMG/M |
| 3300001408|JGI20206J14855_1021043 | Not Available | 1050 | Open in IMG/M |
| 3300001979|JGI24740J21852_10036735 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1518 | Open in IMG/M |
| 3300002184|JGI24770J26754_10128515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 910 | Open in IMG/M |
| 3300003320|rootH2_10000311 | All Organisms → cellular organisms → Bacteria | 277677 | Open in IMG/M |
| 3300003320|rootH2_10265406 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1426 | Open in IMG/M |
| 3300004463|Ga0063356_100608802 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1478 | Open in IMG/M |
| 3300005327|Ga0070658_10203314 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300005327|Ga0070658_11440358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 598 | Open in IMG/M |
| 3300005334|Ga0068869_100030117 | All Organisms → cellular organisms → Bacteria | 3807 | Open in IMG/M |
| 3300005347|Ga0070668_100118546 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2113 | Open in IMG/M |
| 3300005347|Ga0070668_100173586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1756 | Open in IMG/M |
| 3300005347|Ga0070668_101107332 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 715 | Open in IMG/M |
| 3300005365|Ga0070688_101142706 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 624 | Open in IMG/M |
| 3300005455|Ga0070663_100291271 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1304 | Open in IMG/M |
| 3300005455|Ga0070663_101136912 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 684 | Open in IMG/M |
| 3300005530|Ga0070679_100904725 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 826 | Open in IMG/M |
| 3300005534|Ga0070735_10924583 | Not Available | 512 | Open in IMG/M |
| 3300005539|Ga0068853_100077647 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2901 | Open in IMG/M |
| 3300005563|Ga0068855_100022217 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 7603 | Open in IMG/M |
| 3300005841|Ga0068863_102100443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
| 3300005842|Ga0068858_100110549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2566 | Open in IMG/M |
| 3300005842|Ga0068858_100176218 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2018 | Open in IMG/M |
| 3300005844|Ga0068862_100117843 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2337 | Open in IMG/M |
| 3300006048|Ga0075363_100154925 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1295 | Open in IMG/M |
| 3300006237|Ga0097621_100000322 | All Organisms → cellular organisms → Bacteria | 32440 | Open in IMG/M |
| 3300006627|Ga0101571_10896702 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 994 | Open in IMG/M |
| 3300006801|Ga0079223_10929859 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 549 | Open in IMG/M |
| 3300006865|Ga0073934_10055342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 3384 | Open in IMG/M |
| 3300009032|Ga0105048_11056183 | Not Available | 684 | Open in IMG/M |
| 3300009084|Ga0105046_10719582 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 883 | Open in IMG/M |
| 3300009093|Ga0105240_10193503 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium CG_4_10_14_0_2_um_filter_52_9 | 2390 | Open in IMG/M |
| 3300009095|Ga0079224_101381176 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1001 | Open in IMG/M |
| 3300009095|Ga0079224_102895181 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 685 | Open in IMG/M |
| 3300009095|Ga0079224_103891178 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 591 | Open in IMG/M |
| 3300009098|Ga0105245_10565483 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1160 | Open in IMG/M |
| 3300009098|Ga0105245_10792157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 985 | Open in IMG/M |
| 3300009160|Ga0114981_10581427 | Not Available | 596 | Open in IMG/M |
| 3300009448|Ga0114940_10134599 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1100 | Open in IMG/M |
| 3300009553|Ga0105249_13020061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 540 | Open in IMG/M |
| 3300009685|Ga0116142_10055245 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2293 | Open in IMG/M |
| 3300010223|Ga0136270_1000223 | All Organisms → cellular organisms → Bacteria | 23862 | Open in IMG/M |
| 3300010396|Ga0134126_10313173 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1838 | Open in IMG/M |
| 3300011187|Ga0136596_1012360 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2311 | Open in IMG/M |
| 3300011187|Ga0136596_1086722 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 619 | Open in IMG/M |
| 3300012930|Ga0137407_11293328 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 693 | Open in IMG/M |
| 3300012942|Ga0164242_10015306 | All Organisms → cellular organisms → Bacteria | 8031 | Open in IMG/M |
| 3300013105|Ga0157369_11056011 | Not Available | 831 | Open in IMG/M |
| 3300013296|Ga0157374_10000709 | All Organisms → cellular organisms → Bacteria | 29221 | Open in IMG/M |
| 3300013296|Ga0157374_10056251 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 3672 | Open in IMG/M |
| 3300013296|Ga0157374_11006990 | Not Available | 852 | Open in IMG/M |
| 3300013297|Ga0157378_10088587 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2809 | Open in IMG/M |
| 3300013297|Ga0157378_12913684 | Not Available | 531 | Open in IMG/M |
| 3300014159|Ga0181530_10106307 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1668 | Open in IMG/M |
| 3300014165|Ga0181523_10509095 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 665 | Open in IMG/M |
| 3300014200|Ga0181526_10606789 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 691 | Open in IMG/M |
| 3300014208|Ga0172379_10087621 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2466 | Open in IMG/M |
| 3300014325|Ga0163163_10029677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 5263 | Open in IMG/M |
| 3300014325|Ga0163163_10092987 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 3032 | Open in IMG/M |
| 3300014745|Ga0157377_10082259 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1885 | Open in IMG/M |
| 3300014968|Ga0157379_12555010 | Not Available | 511 | Open in IMG/M |
| 3300015084|Ga0167654_1047501 | Not Available | 593 | Open in IMG/M |
| 3300017948|Ga0187847_10020246 | All Organisms → cellular organisms → Bacteria | 4120 | Open in IMG/M |
| 3300020034|Ga0193753_10051886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2194 | Open in IMG/M |
| 3300020034|Ga0193753_10186926 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 959 | Open in IMG/M |
| 3300020583|Ga0210401_11602552 | Not Available | 508 | Open in IMG/M |
| 3300021181|Ga0210388_11141687 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 663 | Open in IMG/M |
| (restricted) 3300021518|Ga0224722_1001310 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 13839 | Open in IMG/M |
| 3300022751|Ga0247817_10283779 | Not Available | 555 | Open in IMG/M |
| 3300023090|Ga0224558_1004785 | All Organisms → cellular organisms → Bacteria | 10315 | Open in IMG/M |
| 3300023095|Ga0247736_10077075 | Not Available | 1147 | Open in IMG/M |
| 3300025310|Ga0209172_10073265 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2037 | Open in IMG/M |
| 3300025323|Ga0209542_10279480 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1439 | Open in IMG/M |
| 3300025721|Ga0209587_1198838 | Not Available | 527 | Open in IMG/M |
| 3300025859|Ga0209096_1106879 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1143 | Open in IMG/M |
| 3300025861|Ga0209605_1087005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1289 | Open in IMG/M |
| 3300025913|Ga0207695_10242184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1704 | Open in IMG/M |
| 3300025921|Ga0207652_11017335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 728 | Open in IMG/M |
| 3300025927|Ga0207687_10000008 | All Organisms → cellular organisms → Bacteria | 497738 | Open in IMG/M |
| 3300025927|Ga0207687_10973753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 727 | Open in IMG/M |
| 3300025927|Ga0207687_11188487 | Not Available | 655 | Open in IMG/M |
| 3300025942|Ga0207689_10898754 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 747 | Open in IMG/M |
| 3300025949|Ga0207667_11750302 | Not Available | 587 | Open in IMG/M |
| 3300025960|Ga0207651_12099699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 507 | Open in IMG/M |
| 3300025972|Ga0207668_10105389 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2104 | Open in IMG/M |
| 3300025972|Ga0207668_10158617 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1760 | Open in IMG/M |
| 3300025986|Ga0207658_10127591 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2038 | Open in IMG/M |
| 3300026035|Ga0207703_10089946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2579 | Open in IMG/M |
| 3300026041|Ga0207639_10055054 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 3043 | Open in IMG/M |
| 3300026078|Ga0207702_12075626 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 558 | Open in IMG/M |
| (restricted) 3300027728|Ga0247836_1203698 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 786 | Open in IMG/M |
| 3300027857|Ga0209166_10049367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria | 2465 | Open in IMG/M |
| 3300027870|Ga0209023_10001379 | All Organisms → cellular organisms → Bacteria | 32718 | Open in IMG/M |
| 3300028374|Ga0306906_1031672 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 903 | Open in IMG/M |
| 3300028380|Ga0268265_10086346 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 2493 | Open in IMG/M |
| (restricted) 3300028557|Ga0247832_1123335 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1049 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1001224 | All Organisms → cellular organisms → Bacteria | 49090 | Open in IMG/M |
| 3300028800|Ga0265338_10001602 | All Organisms → cellular organisms → Bacteria | 36326 | Open in IMG/M |
| 3300028800|Ga0265338_10140874 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1889 | Open in IMG/M |
| 3300029951|Ga0311371_11138323 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 910 | Open in IMG/M |
| 3300031250|Ga0265331_10170277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 986 | Open in IMG/M |
| 3300031525|Ga0302326_10825140 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 1332 | Open in IMG/M |
| 3300032456|Ga0335394_10710295 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium | 749 | Open in IMG/M |
| 3300032895|Ga0335074_11469444 | Not Available | 545 | Open in IMG/M |
| 3300032898|Ga0335072_10080841 | All Organisms → cellular organisms → Bacteria | 4224 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 6.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 5.66% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.66% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.72% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 3.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.77% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.83% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 2.83% |
| Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 2.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.83% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.83% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 2.83% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.89% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 1.89% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.89% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.89% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.89% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.89% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.89% |
| Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 1.89% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.89% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.94% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.94% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.94% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.94% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.94% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.94% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.94% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.94% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.94% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.94% |
| Compost | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost | 0.94% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000476 | ZC3D78 | Engineered | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300001408 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F52-2 deep-092012 | Environmental | Open in IMG/M |
| 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Host-Associated | Open in IMG/M |
| 3300002184 | Freshwater and sediment microbial communities from Lake Erie, Canada | Environmental | Open in IMG/M |
| 3300003320 | Sugarcane root Sample H2 | Host-Associated | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006627 | Soil microbial communities from the Leymus chinensis steppe, China - after adding 28 g N m- 2, yr-1 | Environmental | Open in IMG/M |
| 3300006801 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 | Environmental | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009084 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009095 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2015 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009448 | Groundwater microbial communities from Cold Creek, Nevada to study Microbial Dark Matter (Phase II) - Cold Creek Source | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300010223 | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 3 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011187 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014208 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Groundwater well OW334 metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021518 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Balambano_FR1_MetaG | Environmental | Open in IMG/M |
| 3300022751 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L212-509R-1 | Environmental | Open in IMG/M |
| 3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
| 3300023095 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L193-509B-2 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025323 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank highO2_0.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025721 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025861 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
| 3300028374 | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E11 #897 (v2) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300032456 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-03 (spades assembly) | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ZC3D78_1092642 | 3300000476 | Compost | MKYLSIFFTILFVWVAVLLMALTRDNTTEIFQLYLAVMVSTVVLFLIGFAKK* |
| JGIcombinedJ13530_1098260532 | 3300001213 | Wetland | MKYISIFFTILFIWLAVILMAFARTHTGEIFKLYLAVMISTLVLFLIGFAKK* |
| JGI20206J14855_10210433 | 3300001408 | Arctic Peat Soil | MKYASTFFTILLIWIAVILMSLSVHNSGQVFELFLAVMVSTLVLFLIGFGRS* |
| JGI24740J21852_100367354 | 3300001979 | Corn Rhizosphere | MKYASIFATILFIWIAVIIMALTTTNANQIYGLYLAGIISTLALFVIGFARK* |
| JGI24770J26754_101285152 | 3300002184 | Freshwater And Sediment | MKYISIFFTILLIWIAIVLMAFTRSSATEVFELFLAAIASTVILFLIGFKRK* |
| rootH2_1000031135 | 3300003320 | Sugarcane Root And Bulk Soil | MKYASVFVTIVLIWIAIILMALTRKSPNDVFELYVSAIVATLALFMIGFRKR* |
| rootH2_102654062 | 3300003320 | Sugarcane Root And Bulk Soil | MKYASIFVTIVLIWVAVILMAVTRRDPTDIFELYVSGIVSTLVLFLIGFSKR* |
| Ga0063356_1006088022 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKYISAFITILIIWIAAILIALAHSEASEIFALYLVVMISTLALFLIGFSKK* |
| Ga0070658_102033142 | 3300005327 | Corn Rhizosphere | MKYVSVFATIVLIWIAVILMAATRSVPSEIFKLYVAAIISTLALFVIGFTRG* |
| Ga0070658_114403582 | 3300005327 | Corn Rhizosphere | MKYASVFVTIVLIWIAVILMAATRSAPDEIFKLYIAAIISTLALFVIGFARK* |
| Ga0068869_1000301176 | 3300005334 | Miscanthus Rhizosphere | MKYASIFATIVLIWLAVVLMATTRGDAKEVFELYVTAIISTLVLFVIGFGKR* |
| Ga0070668_1001185464 | 3300005347 | Switchgrass Rhizosphere | MKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK* |
| Ga0070668_1001735861 | 3300005347 | Switchgrass Rhizosphere | MKYISIFFTILFIWIAVIFMAFTRDNTNEIFALYLAVMTSTVILFLIGFAKK* |
| Ga0070668_1011073322 | 3300005347 | Switchgrass Rhizosphere | MKYVSIFFTILFIWIAVIFMAFSRSNTNEIFELYLAVMGSTVVLFLIGFGRK* |
| Ga0070688_1011427062 | 3300005365 | Switchgrass Rhizosphere | MKYASIFFTILIIWIATILMALTREDPNEIFELYLAVTICTLALFLIGFAKK* |
| Ga0070663_1002912712 | 3300005455 | Corn Rhizosphere | MKYASIFATILLIWLAVILMAITRKDPTDIFELYVAAIISTAALFLIGFSKK* |
| Ga0070663_1011369122 | 3300005455 | Corn Rhizosphere | MKYLSIFATILLIWVAVILMALTSNSSQQIYELYLAVIVSTVALFLIGFARK* |
| Ga0070679_1009047252 | 3300005530 | Corn Rhizosphere | MKYASIFLTIVFIWIAVIIMAFTRSSGDQVFDLYLAAIIATLALFIIGFIRR* |
| Ga0070735_109245831 | 3300005534 | Surface Soil | MKYASIFITILLIWVAVILMALTRSKASDIFELYLAVIVSTLALFLI |
| Ga0068853_1000776472 | 3300005539 | Corn Rhizosphere | MKYASIFATILFIWIATIIMAATTTDAHQIYGLYLATIISTLALFIIGFARK* |
| Ga0068855_1000222176 | 3300005563 | Corn Rhizosphere | MKYASIFGTILFIWIAVIIMAATTTDAHQIYGLYLACIVSTLALFIIGFARK* |
| Ga0068863_1021004431 | 3300005841 | Switchgrass Rhizosphere | MEQMKYLSIFFTILFIWVAVILMALTRNNTSQIFQLYLAVMVSTVVLFLIGFAKK* |
| Ga0068858_1001105494 | 3300005842 | Switchgrass Rhizosphere | MEMKYISIFFTILFIWIAVIFMAFTRDNTNEIFDLYLAVMASTLVLFLIGFGKK* |
| Ga0068858_1001762182 | 3300005842 | Switchgrass Rhizosphere | MGQMKYLSIFFTILFIWVAVILMALTRNNTSQIFQLYLAVMVSTVVLFLIGFAKK* |
| Ga0068862_1001178434 | 3300005844 | Switchgrass Rhizosphere | MADPGVAAWRAGIECDKITIEMKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK* |
| Ga0075363_1001549252 | 3300006048 | Populus Endosphere | MKYASIFATILLIWLAVILMAITRRDATDIFELYLTGIVSTMALFLIGFSRRR* |
| Ga0097621_10000032215 | 3300006237 | Miscanthus Rhizosphere | MKYASIFATIVLIWIAIILMALTRKSPSDIFELYVSAIVSTLALFLIGFSKR* |
| Ga0101571_108967022 | 3300006627 | Soil | MKYVSIFATILLIWVAVILMALTSNSSQQIYELYLAVIVCTVALFLIGFARK* |
| Ga0079223_109298591 | 3300006801 | Agricultural Soil | MKYLSIFFTILFIWVAILLMAVTRDDTGEIFQLYLAVMASTVILFLIGFAKK* |
| Ga0073934_100553425 | 3300006865 | Hot Spring Sediment | MRYASIFFTILLIWVAIIFMALTRDDPQEIMQLFLAVNFSTLILFLIGFAKK* |
| Ga0105048_110561832 | 3300009032 | Freshwater | MKYISIFFTILLIWIAVILMALTREAPTEIFQLFLAAIVSTVVLFLIGFSRK* |
| Ga0105046_107195822 | 3300009084 | Freshwater | AIIIMAFTRENTTEIFQLYLAVMGCTIILFLIGFAKK* |
| Ga0105240_101935034 | 3300009093 | Corn Rhizosphere | MKYASIFATILLIWVAVILMAFTSNSATQIYELYLAVIVSTVALFLIGFARK* |
| Ga0079224_1013811762 | 3300009095 | Agricultural Soil | MKYLSIFFTILFIWVAVLLMALTRDDTSEIMQLYLVVMLSTIVLFLIGFAKK* |
| Ga0079224_1028951812 | 3300009095 | Agricultural Soil | MKYLSIFFTILFIWIAVLLMALTRDDTTEIFQLYLAVMVSTVVLFLIGFAKK* |
| Ga0079224_1038911782 | 3300009095 | Agricultural Soil | MKYLSIFFTILFIWVAVILIALTRESSGEIMQLYLAVMVSTVILFMIGFAKK* |
| Ga0105245_105654832 | 3300009098 | Miscanthus Rhizosphere | FLCLSCYTKDTEMKYASIFATILLIWLAVILMAITRKDPTDIFELYVAAIISTAALFLIGFSKK* |
| Ga0105245_107921572 | 3300009098 | Miscanthus Rhizosphere | MKYASIFFTILIIWIATILMALTRSNPDEIFELYLAVTVSTLALFLIGFAKK* |
| Ga0114981_105814271 | 3300009160 | Freshwater Lake | MKYLSIFLTILFIWIAVILMAFTREKTNEIFQLYLAVMLSTVVLFLIGFAKK* |
| Ga0114940_101345991 | 3300009448 | Groundwater | LFIWIAVIFMAFTRDNTNEIFALYLAVMTSTVILFLIGFAKK* |
| Ga0105249_130200611 | 3300009553 | Switchgrass Rhizosphere | CDKITIEMKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK* |
| Ga0116142_100552452 | 3300009685 | Anaerobic Digestor Sludge | MKYLSIFFTILFIWVAVILMALTRENSSEIFQLYFVVMVSTVILFLIGFAKK* |
| Ga0136270_10002235 | 3300010223 | Freshwater | MKYASIFFTILFIWLAIIIMAFSSPSTKEVFQLYLTVMLSTIVLFLIGFARK* |
| Ga0134126_103131734 | 3300010396 | Terrestrial Soil | MKYASIFFTILLIWVAVILMALTQSNGHQVFELYLAVMVSTLALFLIGFARK* |
| Ga0136596_10123604 | 3300011187 | Saline Lake | MRYASIFATILLIWIAVVIMAFTRNSPNEIFELYLAVVVSTLFLFMIGFARR* |
| Ga0136596_10867222 | 3300011187 | Saline Lake | MRYASIFVTILLIWIAVIVMAFTRANPNEIFELYLAVIASTLILFLIGFARK* |
| Ga0137407_112933282 | 3300012930 | Vadose Zone Soil | MKYASIFATIVLIWVATILMALTRKNPNDIFDLYVAAIVSTLALFLIGFRKR* |
| Ga0164242_100153064 | 3300012942 | Compost | MKYASIFATILFIWVAVVIMALTTSDVHQIYWLYLSGIISTLALFVIGFARK* |
| Ga0157369_110560111 | 3300013105 | Corn Rhizosphere | MKYASIFATILFIWIAVIIMAFTTKSADQLYALYLACIVSTLALFLIGFARK* |
| Ga0157374_1000070918 | 3300013296 | Miscanthus Rhizosphere | MKYASIFATILFIWIAVIIMALTTTDAKQIYGLYLACIVSTLALFLIGFARK* |
| Ga0157374_100562514 | 3300013296 | Miscanthus Rhizosphere | MREMKYASIFATILLIWFAVILMAITRRDPSDIFKLYLAAIISTVALFLIGFTKR* |
| Ga0157374_110069901 | 3300013296 | Miscanthus Rhizosphere | MKYVSVFATIVLIWTAVILMAVTRKDAGQIFELYISAIVSTIAL |
| Ga0157378_100885872 | 3300013297 | Miscanthus Rhizosphere | MKYASIFFTILIIWIATILMALTRSDPGEIFDLYIAVTVSTLALFLIGFAKK* |
| Ga0157378_129136842 | 3300013297 | Miscanthus Rhizosphere | MKYASIFFTILIIWIATILMALTRHNPNEIFELYLAVTISTLALFLIGFAK |
| Ga0181530_101063074 | 3300014159 | Bog | MKYASIFFTILFIWVAVILMALTRRNSSEIFQLYLAVIASTLALFLIGFARK* |
| Ga0181523_105090952 | 3300014165 | Bog | KYASIFFTILFIWVAVILMALTRRNSGEIFELYLAVIASTLALFLIGFARK* |
| Ga0181526_106067892 | 3300014200 | Bog | MKYASIFFTILFIWVAVILMALTRRNSSEIFELYLAVIASTLALFLIGFARK* |
| Ga0172379_100876211 | 3300014208 | Groundwater | ITILFIWVAVILMALTRHDAKEIFQLYIAVMVCTLALFLIGFGKK* |
| Ga0163163_100296775 | 3300014325 | Switchgrass Rhizosphere | MEQMKYLSIFFTILFIWVAVILMALTRDNTSQIFQLYLAVMVSTIVLFLIGFAKK* |
| Ga0163163_100929872 | 3300014325 | Switchgrass Rhizosphere | MKYASIFATIVLIWIAIILMATTRSGATQAFELYITAIICTFALFIIGFSRR* |
| Ga0157377_100822593 | 3300014745 | Miscanthus Rhizosphere | MKYVSVFATIVLIWTAVILMAVTRKDAGQIFELYISAIVSTIALFLIGFSKQ* |
| Ga0157379_125550101 | 3300014968 | Switchgrass Rhizosphere | MRYASIFATILFIWVAVIVMALTTNSASQIYGLYLAAIVSTVAMFLI |
| Ga0167654_10475012 | 3300015084 | Glacier Forefield Soil | MKYVSIFFTILLIWIAVILMAFTRSDTNQLFQLYLTAIVSTVVLFLIGFAKK* |
| Ga0187847_100202465 | 3300017948 | Peatland | MKYASTFFTILLIWVAVILMSLTINNSGQVFELFVAVMISTLMLFLIGFGGRA |
| Ga0193753_100518862 | 3300020034 | Soil | MKYISIFFTILFIWIAVIFMAFSRNNTNEIFELYLAVMFSTLILFLIGFGKK |
| Ga0193753_101869263 | 3300020034 | Soil | MRYASIFFTILFIWLAVILIALTRHSSGEIFELYLAVMVCTVLLFLIGFGKKQ |
| Ga0210401_116025522 | 3300020583 | Soil | FMKYASTFFTILLIWIAVILMSLTVHDSGQVFELYVAVMVSTLLLFLIGFGRA |
| Ga0210388_111416871 | 3300021181 | Soil | YNSKSMKYASIFFTIVLIWIAVILMAASRSSSGEIFQLYVAAIISTLALFLIGFTKK |
| (restricted) Ga0224722_100131010 | 3300021518 | Freshwater Sediment | MKYLSIFFTILFIWIAVIFMALTRDRTSEIFQLYLAVMLSTVVLFLIGFAKK |
| Ga0247817_102837792 | 3300022751 | Plant Litter | MKYLSIFFTILFIWVAVILMAITRDDSAEIFQLYLAVMVSTLVLFLIGFAKK |
| Ga0224558_100478512 | 3300023090 | Soil | MKYASIFFTILFIWVAVILMALTRRNSSEIFELYLAVIASTLALFLIGFARK |
| Ga0247736_100770752 | 3300023095 | Plant Litter | MKYISIFFTILFIWIAVIFMAFSRSNTNEIFELYLAVMVSTLVLFLIGFGKK |
| Ga0209172_100732653 | 3300025310 | Hot Spring Sediment | MRYASIFFTILLIWVAIIFMALTRDDPQEIMQLFLAVNFSTLILFLIGFAKK |
| Ga0209542_102794802 | 3300025323 | Soil | MRYASIFFTILFIWLAVVLMALTRHNSSEIFELYIAVMICTVLLFLIGFGKK |
| Ga0209587_11988382 | 3300025721 | Arctic Peat Soil | MKYVSIFFTILLIWIAIILMAITRNNPTEIFELFLAAIGSTVVLFLIGFARK |
| Ga0209096_11068791 | 3300025859 | Anaerobic Digestor Sludge | MKYLSIFFTILFIWVAVILMALTRENSSEIFQLYFVV |
| Ga0209605_10870051 | 3300025861 | Anaerobic Digestor Sludge | LFIWIAVLLMALTRDDTTEIFQLYLAVMVSTVVLFLIGFAKK |
| Ga0207695_102421842 | 3300025913 | Corn Rhizosphere | SIFATILLIWVAVILMAFTSNSATQIYELYLAVIVSTVALFLIGFARK |
| Ga0207652_110173352 | 3300025921 | Corn Rhizosphere | MKYASIFLTIVFIWIAVIIMAFTRSSGDQVFDLYLAAIIATLALFIIGFIRR |
| Ga0207687_10000008133 | 3300025927 | Miscanthus Rhizosphere | MKYASIFATIVLIWIAIILMALTRKSPSDIFELYVSAIVSTLALFLIGFSKR |
| Ga0207687_109737533 | 3300025927 | Miscanthus Rhizosphere | MKYASIFFTILIIWIATILMALTRSNPDEIFELYLAVTVSTLALFLIGFAKK |
| Ga0207687_111884871 | 3300025927 | Miscanthus Rhizosphere | MRYASIFFTILFIWLAVILMALTRHKSGEIFELYIAVMTCTVLL |
| Ga0207689_108987542 | 3300025942 | Miscanthus Rhizosphere | MKYASIFATIVLIWLAVVLMATTRGDAKEVFELYVTAIISTLVLFVIGFGKR |
| Ga0207667_117503021 | 3300025949 | Corn Rhizosphere | MKYASIFGTILFIWIAVIIMAATTTDAHQIYGLYLACIVSTLALFIIGFARK |
| Ga0207651_120996991 | 3300025960 | Switchgrass Rhizosphere | SKCCIINVIMKYASIFFTILIIWIATILMALTRTNPNEIFELYLAVIISTLALFLIGFAK |
| Ga0207668_101053894 | 3300025972 | Switchgrass Rhizosphere | MKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK |
| Ga0207668_101586172 | 3300025972 | Switchgrass Rhizosphere | MKYISIFFTILFIWIAVIFMAFTRDNTNEIFALYLAVMTSTVILFLIGFAKK |
| Ga0207658_101275912 | 3300025986 | Switchgrass Rhizosphere | MGQMKYLSIFFTILFIWVAVILMALTRNNTSQIFQLYLAVMVSTVVLFLIGFAKK |
| Ga0207703_100899462 | 3300026035 | Switchgrass Rhizosphere | MEMKYISIFFTILFIWIAVIFMAFTRDNTNEIFDLYLAVMASTLVLFLIGFGKK |
| Ga0207639_100550544 | 3300026041 | Corn Rhizosphere | MKYASIFATILFIWIATIIMAATTTDAHQIYGLYLATIISTLALFIIGFARK |
| Ga0207702_120756261 | 3300026078 | Corn Rhizosphere | IVLIWVAVILMATTRHDPTQIFQLYLTAIVCTIALFFIGFARR |
| (restricted) Ga0247836_12036982 | 3300027728 | Freshwater | MKYLSIFFTILFIWIAVILMALTRDKTNEIFQLYLAVMLSTVVLFLIGFAKK |
| Ga0209166_100493671 | 3300027857 | Surface Soil | MKYASIFATIVLIWVAIILMATTRSAVHQIFELYITGIVSTFALFIIGFSRR |
| Ga0209023_1000137917 | 3300027870 | Freshwater And Sediment | MKYISIFFTILLIWIAIVLMAFTRSSATEVFELFLAAIASTVILFLIGFKRK |
| Ga0306906_10316723 | 3300028374 | Saline Lake | MRYASIFATILLIWIAVVIMAFTRNSPNEIFELYLAVVVSTLFLFMIGFARR |
| Ga0268265_100863462 | 3300028380 | Switchgrass Rhizosphere | MADPGVAAWRAGIECDKITIEMKYVSIFFTILFIWIAVIFMSFTRSDTNEIFALYLAVMGSTVVLFLIGFGRK |
| (restricted) Ga0247832_11233351 | 3300028557 | Freshwater | YDKISYRMKYLSIFFTILFIWIAVILMALTRDKTNEIFQLYLAVMLSTVVLFLIGFAKK |
| (restricted) Ga0247844_100122443 | 3300028571 | Freshwater | VILMALTRDKTNEIFQLYLAVMLSTVVLFLIGFAKK |
| Ga0265338_1000160213 | 3300028800 | Rhizosphere | MKYASVFATIVLIWIAVILMAVTRTAAHKIFELYLTAIFSTLVLFLIGFTRS |
| Ga0265338_101408743 | 3300028800 | Rhizosphere | MKYASIFFTILLIWIAVILMALTRTNANDIFDLYLAVIVSTLALFLIGFARK |
| Ga0311371_111383231 | 3300029951 | Palsa | IVLIWIAIILMAATRSVPSEIFKLYVAAIISTLSLFLIGFTRS |
| Ga0265331_101702772 | 3300031250 | Rhizosphere | MKYISIFFTILLIWVAVILMAFTRNDSREIFELFLAAIASTVVLFLIGFTRK |
| Ga0302326_108251402 | 3300031525 | Palsa | MKYASIFATILMIWVAVILMAVTRKSAHEIFDLYVSAILSTLALFLIGFSKR |
| Ga0335394_107102952 | 3300032456 | Freshwater | MLPMKYASIFFTILFIWLAIIIMAFTRSDTNEIFQLYLVVMACTVILFLIGFAKK |
| Ga0335074_114694441 | 3300032895 | Soil | MKYASIFVTIVLIWIAVILMAVTRHQANAIFELYVAAMASTLMLFLIGFSRK |
| Ga0335072_100808414 | 3300032898 | Soil | MKYVSVFATIVLIWIAVILMAATRSVPSEIFKLYIAAIISTLALFLIGFTRA |
| ⦗Top⦘ |