NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F069483

Metagenome / Metatranscriptome Family F069483

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F069483
Family Type Metagenome / Metatranscriptome
Number of Sequences 124
Average Sequence Length 77 residues
Representative Sequence LRWRAPSERIRTASEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMPFTSIAERLGINLWMAKKAARWGNIQKA
Number of Associated Samples 101
Number of Associated Scaffolds 124

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 33.87 %
% of genes near scaffold ends (potentially truncated) 50.81 %
% of genes from short scaffolds (< 2000 bps) 71.77 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.742 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(21.774 % of family members)
Environment Ontology (ENVO) Unclassified
(45.968 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(57.258 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.16%    β-sheet: 0.00%    Coil/Unstructured: 57.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 124 Family Scaffolds
PF13784Fic_N 8.87
PF13470PIN_3 4.84
PF02661Fic 4.03
PF02518HATPase_c 1.61
PF09660DUF2397 1.61
PF01170UPF0020 1.61
PF13701DDE_Tnp_1_4 1.61
PF12802MarR_2 1.61
PF04851ResIII 1.61
PF08843AbiEii 1.61
PF08279HTH_11 0.81
PF13443HTH_26 0.81
PF14462Prok-E2_E 0.81
PF00004AAA 0.81
PF03852Vsr 0.81
PF12681Glyoxalase_2 0.81
PF13358DDE_3 0.81
PF13487HD_5 0.81
PF07883Cupin_2 0.81
PF00881Nitroreductase 0.81
PF04014MazE_antitoxin 0.81
PF13419HAD_2 0.81
PF01814Hemerythrin 0.81
PF06114Peptidase_M78 0.81
PF13361UvrD_C 0.81
PF14559TPR_19 0.81
PF00271Helicase_C 0.81
PF13280WYL 0.81
PF04191PEMT 0.81
PF07045DUF1330 0.81
PF13565HTH_32 0.81
PF03601Cons_hypoth698 0.81
PF01966HD 0.81
PF069833-dmu-9_3-mt 0.81
PF13602ADH_zinc_N_2 0.81
PF13412HTH_24 0.81
PF00501AMP-binding 0.81
PF13338AbiEi_4 0.81

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 124 Family Scaffolds
COG0286Type I restriction-modification system, DNA methylase subunitDefense mechanisms [V] 1.61
COG4123tRNA1(Val) A37 N6-methylase TrmN6Translation, ribosomal structure and biogenesis [J] 1.61
COG2890Methylase of polypeptide chain release factorsTranslation, ribosomal structure and biogenesis [J] 1.61
COG281316S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmGTranslation, ribosomal structure and biogenesis [J] 1.61
COG2265tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD familyTranslation, ribosomal structure and biogenesis [J] 1.61
COG2264Ribosomal protein L11 methylase PrmATranslation, ribosomal structure and biogenesis [J] 1.61
COG2263Predicted RNA methylaseGeneral function prediction only [R] 1.61
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 1.61
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 1.61
COG109223S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmITranslation, ribosomal structure and biogenesis [J] 1.61
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.61
COG011623S rRNA G2445 N2-methylase RlmLTranslation, ribosomal structure and biogenesis [J] 1.61
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.81
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 0.81
COG3727G:T-mismatch repair DNA endonuclease Vsr, very short patch repair proteinReplication, recombination and repair [L] 0.81
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.81
COG5470Uncharacterized conserved protein, DUF1330 familyFunction unknown [S] 0.81


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.74 %
UnclassifiedrootN/A7.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908032|Perma_A_C_ConsensusfromContig186701All Organisms → cellular organisms → Bacteria → Proteobacteria4160Open in IMG/M
2140918006|ConsensusfromContig48600All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria968Open in IMG/M
3300001380|JGI1356J14229_10118931All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria921Open in IMG/M
3300002118|C687J26622_1000229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6248Open in IMG/M
3300002121|C687J26615_10069372Not Available878Open in IMG/M
3300002123|C687J26634_10059824All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1417Open in IMG/M
3300002243|C687J29039_10007026All Organisms → cellular organisms → Bacteria4676Open in IMG/M
3300002243|C687J29039_10194611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium715Open in IMG/M
3300002407|C687J29651_10090269Not Available1036Open in IMG/M
3300002485|C687J35088_10017838All Organisms → cellular organisms → Bacteria2410Open in IMG/M
3300002485|C687J35088_10194165All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium596Open in IMG/M
3300002530|C687J35503_10004474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3973Open in IMG/M
3300003987|Ga0055471_10024601All Organisms → cellular organisms → Bacteria1481Open in IMG/M
3300003997|Ga0055466_10012636All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300004013|Ga0055465_10305795All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium548Open in IMG/M
3300005880|Ga0075298_1019223All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium635Open in IMG/M
3300006224|Ga0079037_100140807All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2097Open in IMG/M
3300006972|Ga0075518_1069667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium704Open in IMG/M
3300007351|Ga0104751_1002534All Organisms → cellular organisms → Bacteria28079Open in IMG/M
3300007351|Ga0104751_1050286All Organisms → cellular organisms → Bacteria2014Open in IMG/M
3300008003|Ga0100391_1044887All Organisms → cellular organisms → Bacteria2856Open in IMG/M
3300008011|Ga0100396_1194977All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG_4_9_14_3_um_filter_65_9781Open in IMG/M
3300008093|Ga0100393_10380423All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CG_4_9_14_3_um_filter_65_9660Open in IMG/M
3300009004|Ga0100377_1378678All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria510Open in IMG/M
3300009010|Ga0075519_1036828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium577Open in IMG/M
3300009029|Ga0066793_10329872All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria880Open in IMG/M
3300009078|Ga0105106_10093144All Organisms → cellular organisms → Bacteria2217Open in IMG/M
3300009296|Ga0103681_1008494All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6059Open in IMG/M
3300011402|Ga0137356_1038842All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria887Open in IMG/M
3300011413|Ga0137333_1019259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1507Open in IMG/M
3300011419|Ga0137446_1055340All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria893Open in IMG/M
3300011436|Ga0137458_1018727All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1684Open in IMG/M
3300012113|Ga0137328_1004261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1072Open in IMG/M
3300012146|Ga0137322_1005489All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1521Open in IMG/M
3300012157|Ga0137353_1040283Not Available833Open in IMG/M
3300012161|Ga0137336_1011955Not Available1508Open in IMG/M
3300012164|Ga0137352_1012836All Organisms → cellular organisms → Bacteria1519Open in IMG/M
3300012166|Ga0137350_1132317All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300012168|Ga0137357_1012012All Organisms → cellular organisms → Bacteria → Proteobacteria1667Open in IMG/M
3300012171|Ga0137342_1032981All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria996Open in IMG/M
3300012171|Ga0137342_1047530All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium860Open in IMG/M
3300012673|Ga0137339_1014459All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium769Open in IMG/M
3300012964|Ga0153916_10154458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2243Open in IMG/M
3300012964|Ga0153916_12765288All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium553Open in IMG/M
(restricted) 3300013131|Ga0172373_10104205Not Available2134Open in IMG/M
(restricted) 3300013132|Ga0172372_10511298All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium793Open in IMG/M
3300013232|Ga0170573_11049659All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1379Open in IMG/M
3300014271|Ga0075326_1025340Not Available1489Open in IMG/M
3300014301|Ga0075323_1049217All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium821Open in IMG/M
3300014311|Ga0075322_1001513All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3640Open in IMG/M
3300014873|Ga0180066_1071430All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium704Open in IMG/M
3300014875|Ga0180083_1004984All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2058Open in IMG/M
3300014877|Ga0180074_1024779All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1188Open in IMG/M
3300014884|Ga0180104_1009211All Organisms → cellular organisms → Bacteria2259Open in IMG/M
3300014885|Ga0180063_1033734All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.1436Open in IMG/M
3300015249|Ga0180071_1004210All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1363Open in IMG/M
3300015250|Ga0180072_1066319All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300015250|Ga0180072_1078992All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium576Open in IMG/M
3300015253|Ga0180081_1014303All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1137Open in IMG/M
3300015254|Ga0180089_1012609All Organisms → cellular organisms → Bacteria1484Open in IMG/M
3300015254|Ga0180089_1056136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium783Open in IMG/M
3300015254|Ga0180089_1103048All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium593Open in IMG/M
3300015257|Ga0180067_1086116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300018055|Ga0184616_10214036All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300018083|Ga0184628_10701924All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria504Open in IMG/M
3300018084|Ga0184629_10095853All Organisms → cellular organisms → Bacteria → Proteobacteria1444Open in IMG/M
3300021063|Ga0206227_1012819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1289Open in IMG/M
3300025001|Ga0209618_1001444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4848Open in IMG/M
3300025017|Ga0210022_1031425All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2049Open in IMG/M
3300025088|Ga0208246_1006254All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria4556Open in IMG/M
3300025146|Ga0209322_10039835All Organisms → cellular organisms → Bacteria2295Open in IMG/M
3300025160|Ga0209109_10370733All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria671Open in IMG/M
3300025164|Ga0209521_10165480All Organisms → cellular organisms → Bacteria1355Open in IMG/M
3300025164|Ga0209521_10600792Not Available554Open in IMG/M
3300025167|Ga0209642_10596317All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium602Open in IMG/M
3300025289|Ga0209002_10320261All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria906Open in IMG/M
3300025289|Ga0209002_10691536All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300025308|Ga0209211_10067848All Organisms → cellular organisms → Bacteria3028Open in IMG/M
3300025313|Ga0209431_10588065All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300025313|Ga0209431_10694446All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium752Open in IMG/M
3300025318|Ga0209519_10285290All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria960Open in IMG/M
3300025319|Ga0209520_10157426All Organisms → cellular organisms → Bacteria1440Open in IMG/M
3300025324|Ga0209640_10021022All Organisms → cellular organisms → Bacteria → Proteobacteria5692Open in IMG/M
3300025324|Ga0209640_10054399All Organisms → cellular organisms → Bacteria3472Open in IMG/M
3300025325|Ga0209341_10003327All Organisms → cellular organisms → Bacteria15056Open in IMG/M
3300025326|Ga0209342_10851745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium711Open in IMG/M
3300025524|Ga0209817_1021587All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1055Open in IMG/M
3300025791|Ga0210115_1015752All Organisms → cellular organisms → Bacteria → Proteobacteria1743Open in IMG/M
3300025796|Ga0210113_1080203All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium650Open in IMG/M
3300025979|Ga0210078_1003764All Organisms → cellular organisms → Bacteria1698Open in IMG/M
3300026028|Ga0208420_1016369All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300026090|Ga0208912_1025111Not Available857Open in IMG/M
3300027819|Ga0209514_10015048All Organisms → cellular organisms → Bacteria7534Open in IMG/M
3300027819|Ga0209514_10192311All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1034Open in IMG/M
3300027831|Ga0209797_10311274Not Available652Open in IMG/M
3300027900|Ga0209253_11141907All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria527Open in IMG/M
3300028028|Ga0265292_1009604All Organisms → cellular organisms → Bacteria4302Open in IMG/M
3300028032|Ga0265296_1094390All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.1170Open in IMG/M
3300030613|Ga0299915_10108529All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300031834|Ga0315290_10157830All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1955Open in IMG/M
3300031873|Ga0315297_10122302All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2087Open in IMG/M
3300031873|Ga0315297_11023127All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium682Open in IMG/M
3300031949|Ga0214473_10014082All Organisms → cellular organisms → Bacteria → Proteobacteria9370Open in IMG/M
3300031949|Ga0214473_10157070All Organisms → cellular organisms → Bacteria2644Open in IMG/M
3300031949|Ga0214473_10198786All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2321Open in IMG/M
3300031949|Ga0214473_10636771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1171Open in IMG/M
3300031949|Ga0214473_10771033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1040Open in IMG/M
3300031997|Ga0315278_10012840All Organisms → cellular organisms → Bacteria7763Open in IMG/M
3300031997|Ga0315278_10796847All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium955Open in IMG/M
3300032173|Ga0315268_10374435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1389Open in IMG/M
3300032516|Ga0315273_10391394All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1875Open in IMG/M
3300032516|Ga0315273_11178855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium966Open in IMG/M
3300033233|Ga0334722_10022526All Organisms → cellular organisms → Bacteria5349Open in IMG/M
3300033233|Ga0334722_10053781All Organisms → cellular organisms → Bacteria → Proteobacteria3165Open in IMG/M
3300033233|Ga0334722_11013551All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium584Open in IMG/M
3300033414|Ga0316619_11481527All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium608Open in IMG/M
3300033417|Ga0214471_10000967All Organisms → cellular organisms → Bacteria23323Open in IMG/M
3300033513|Ga0316628_100516076All Organisms → cellular organisms → Bacteria1544Open in IMG/M
3300033814|Ga0364930_0034096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1723Open in IMG/M
3300033814|Ga0364930_0192598All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300033815|Ga0364946_155000All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300034155|Ga0370498_015463All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1600Open in IMG/M
3300034165|Ga0364942_0283520All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300034388|Ga0373907_053140All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium CSP1-8933Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil21.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil13.71%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment8.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.26%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil4.84%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer4.03%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.03%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.23%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater2.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.42%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.42%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.61%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.61%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.61%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.61%
Deep Subsurface AquiferEnvironmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Deep Subsurface Aquifer1.61%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.81%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.81%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.81%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.81%
GroundwaterEnvironmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater0.81%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.81%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.81%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.81%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.81%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.81%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.81%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate0.81%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.81%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry0.81%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
2140918006Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
3300001380Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 mEnvironmentalOpen in IMG/M
3300002118Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1EnvironmentalOpen in IMG/M
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300002123Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3EnvironmentalOpen in IMG/M
3300002243Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2EnvironmentalOpen in IMG/M
3300002407Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1EnvironmentalOpen in IMG/M
3300002485Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1EnvironmentalOpen in IMG/M
3300002530Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_3EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300005880Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_201EnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006972Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-AEnvironmentalOpen in IMG/M
3300007351Combined Assembly of Gp0115775, Gp0115815EnvironmentalOpen in IMG/M
3300008003Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-15EnvironmentalOpen in IMG/M
3300008011Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20EnvironmentalOpen in IMG/M
3300008093Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-17EnvironmentalOpen in IMG/M
3300009004Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-01EnvironmentalOpen in IMG/M
3300009010Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-IEnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009296Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2umEnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011436Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2EnvironmentalOpen in IMG/M
3300012113Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT100_2EnvironmentalOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012161Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2EnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012166Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT660_2EnvironmentalOpen in IMG/M
3300012168Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012673Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT399_2EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013232Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1EngineeredOpen in IMG/M
3300014271Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2EnvironmentalOpen in IMG/M
3300014301Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1EnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014875Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_1_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015249Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10DEnvironmentalOpen in IMG/M
3300015250Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293B_16_10DEnvironmentalOpen in IMG/M
3300015253Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10DEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015257Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10DEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300021063Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4EnvironmentalOpen in IMG/M
3300025001Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes)EnvironmentalOpen in IMG/M
3300025017Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-20 (SPAdes)EnvironmentalOpen in IMG/M
3300025088Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025308Soil microbial communities from Rifle, Colorado, USA - Groundwater A2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025524Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB136-A (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025979Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026028Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026090Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300028028Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 296AEngineeredOpen in IMG/M
3300028032Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1EnvironmentalOpen in IMG/M
3300030613Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033414Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_BEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M
3300034388Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - B3A4.2EngineeredOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Perma_A_C_029569202124908032SoilVGKEWRAPSERIRTASEIPIEVDLTDEDAIPAYRKISEKVLHLRRLGMEYAKVAERLGVNLWMAKKAGRWSRPAPLSPNEFIKDDE
P1_C_011706002140918006SoilMEKWRAPSERIRTASEIPIEVDLTDEDAVLIYMKISEKVVHLRRLGMSYTSIAEHLGANIWMAKKAARWGNTQKG
JGI1356J14229_1011893113300001380GroundwaterIRTASEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMTYTNIAEHLGINRWMAKEAARWGNIQKA*
C687J26622_100022993300002118SoilLAICEVQEGSTNIEWRAPSERIRTASEIPIEVALTDEDAVPTYVKTTDKVLHLRRLGMTCASIAERLGINLWMAKRAARWAKTR*
C687J26615_1006937223300002121SoilLKWRAPSERIRTASEIPIEVNLTDEDAVPVYMKISEKVLHLRRLGMTYAAIAERLGVNVQMAKRANHWGKAHREKRKSPPHL*
C687J26634_1005982413300002123SoilWRAPSERIRTASEIPIEVALTDEDAVPTYVKTTDKVLHLRRLGMTYASIAERLGINLWMAKRAARWAKTR*
C687J29039_1000702613300002243SoilMRWRAPSERIRTASEIPIEVDLTNVDAIPAYIRISEKVIHLRRLGMTYTSISERLGVNVWMAKRAACPPGRHHQE*
C687J29039_1019461123300002243SoilMNQGVNWRAPSERIRTVSEIHIEVDLKDEDAVPTYVKIAGKVLHLRRLGMPYASICERLDVKRWMALRAVRWSKTRQMECGSEPLST*
C687J29651_1009026923300002407SoilLKWRAPSERIRTVSEIHIEVDLKDEDAVPTYVKIAGKVLHLRRLGMPYASICERLDVKRWMALRAVRWSKTRQMECGSEPLST*
C687J35088_1001783813300002485SoilWRAPSERIRTASEIPIEVNLTDEDAVPVYMKISEKVLHLRRLGMTYAAIAERLGVNLWMAKRAACPPRXHHQG*
C687J35088_1019416523300002485SoilRCTARLGVRISSSGMEKDWRAPSERIRTASEILIEVDLTNEDVVPIYIKISNNVLHLRRLGMTYPAIANRLGVNLWTAKKAAPWGKAHQEKRKSPSH*
C687J35503_1000447413300002530SoilWRAPSERIRTASEIPIEVALTDEDAVPTYVKTTDKVLHLRRLGMTCASIAERLGINLWMAKRAARWAKTR*
Ga0055471_1002460123300003987Natural And Restored WetlandsMLLLARPSERIRTASEIPTGVELTNDVAIPISMSISDKVLRLRRLDMTYTNIAERLGINPWMAKKAARWGNTQKG*
Ga0055466_1001263633300003997Natural And Restored WetlandsIWRAPSERIRTASEIPIEVDLMNEDAVPIYMKISEKALHLRRLGMTYPNIAERLGINPWMAKKAARWGNTQKG*
Ga0055465_1030579523300004013Natural And Restored WetlandsMLLLARPSERIRTASEILIEVELRDEASVPAYMKISEKVLHLRRLGMAYSKISEHLRVNLWMAKKAARWDKAQNK*
Ga0075298_101922323300005880Rice Paddy SoilLRWRAPSERIRTASEILIEVELRDEASVPAYMKISEKVLHLRRLGMAYSKISEHLGVNLWMAKKAARWAKAQNK*
Ga0079037_10014080713300006224Freshwater WetlandsAPSERIRTASEIPIEVDLTDEAAVPTHIRISEKVLHLRRLGMTYTGIAERLGVNLWVAKKASRWGKGQTGLTRMPTKRIM*
Ga0075518_106966723300006972Arctic Peat SoilVGKEWRAPSERIRTASEIPIEMDLTDDAAVPTYIKIAGKVLHLRRLSMAYTSIAKRLGVDLWMAKRAAQ*
Ga0104751_100253423300007351Deep Subsurface AquiferLKWRATSERIQTASEIPIEVDLTDEDAVPIYMRISDKVLHLRRLGMTYTNIAERLGINPWMAKKAARWGNIRKG*
Ga0104751_105028613300007351Deep Subsurface AquiferSERIRTASEIPIEVDLIDEDAVPTYVKISETVLHLRRLGMSYTSIAERLGVNLWMVKKATRRVKIHM*
Ga0100391_104488713300008003AquiferSERIRTASEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMPFTSIAEHLGINPWMAKKAARWGNIRKA*
Ga0100396_119497713300008011AquiferKWRAPSERIRTASEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMPFTSIAEHLGINPWMAKKAARWGNIRKA*
Ga0100393_1038042313300008093AquiferIKEKWRARSERIRTASEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMPFTSIAEHLGINPWMAKKAARWGNIRKA*
Ga0100377_137867813300009004AquiferRAPSERIRTASEIPIEADLTDEDATPIYMRISDKVLHLRRLGMPFTSIAEHLGINPWMAKKAARWGNIRKA*
Ga0075519_103682813300009010Arctic Peat SoilRWTVKHGIPRSRAVHAESHDLAIFSITETELMEKWRVPSERIRTASEIPIEVDLTDKDAIPVYMRISDKVLHLHRLGMTYTNIAERLGINPWMAKKAARWGNIQKA*
Ga0066793_1032987213300009029Prmafrost SoilMAIQAESHHKSAISSITESMEKWRAPSERIRTASVIPIEVGLTDEDAIPIYMRISDKVLYLRRLGMTYTNIAERLGINPWMAKKAARWGNTQKG*
Ga0105106_1009314443300009078Freshwater SedimentMGGGWRAPSERIRTISEIPIEVDLTDEDAVPAYMKISEKVLHLRRLGMAYAIIAERLGVNLWMAKK
Ga0103681_100849433300009296GroundwaterVRLAFESPGDRDGKRVARPERIRTASEIPIEVDLTDEDTIPIYMRISDKVLHLRRLGMTYTNIARPLGINPWMAKKAARWGNIQKG*
Ga0137356_103884213300011402SoilNQGREKWCAPSERIRTASEIPVELDLMDEDAIPIYMRISDKVLHLRRLGMPFTSIAERLGINPWMAKKAARWSNIQKA*
Ga0137333_101925913300011413SoilPSERIRTASEIPIQVELTDEEAIPIYMRISDKVLHLRRLGMPYATIAERLKINLWMAKRAARWGNIQKA*
Ga0137446_105534023300011419SoilAGKVWRAPSERIRTASEIPIEVNLTDEGAVPVYMKISEKVLHLRRLGMAYATIAERLKINLWMAKRAARWGKTHLKRRENTSPY*
Ga0137458_101872713300011436SoilLAISSITESMEKWRAPSERIRTASEIPIEVDLMDEDAIPIYMRISDKVLHLRRMGMTYTNIAERLGINPWMAKKAARWGNIQKA*
Ga0137328_100426123300012113SoilMASPGNVSAMVMQSHEGIEWRAPSERIRTASEIPIEMDLTDEDAIPIYMRISDKVLHLRRLGMTYTNIAEHLGINPWMAKKAARWGNIQKG*
Ga0137322_100548913300012146SoilALLPSSAQLRPAWRAPSERIRTASEIPIQVDLTDEDTIPIYMRISDKVLHLRRLGMTYTNIAERLGINPWMAKKAARWGNIQKA*
Ga0137353_104028323300012157SoilAPSERIRTASEIPIGVELMDEASVPAYMKISEKVLHLRRLGMAYSKIAEHLGVNPWMAKKAARWGYIQKG*
Ga0137336_101195523300012161SoilMGREWRAPSERIRTASEIPIGVELMDEASVPAYMKISEKVLHLRRLGMAYSKIAEHLGVNPWMAKKAARWGYIQKG*
Ga0137352_101283613300012164SoilREWRAPSERIRTASEIPIGVELMDEASVPAYMKISEKVLHLRRLGMAYSKIAEHLGVNPWMAKKAARWGYIQKG*
Ga0137350_113231713300012166SoilAPSERIRTASEIPIEMNLTDEDAIPIYMKISEKVLHLRRLGMGYTNIAERIGVNLWMAKKAARWAYRKEDPRRLE*
Ga0137357_101201233300012168SoilMGREWRAPSERIRTASEIPIVMDLTDKDAVPVYMKISEKVLHLRRLGMLYASIADRLGVNLWMVKKAARWATNDHKTKDA
Ga0137342_103298113300012171SoilMGREWRAPSERIRTASEIPVEVDLTDKDAIPAYMKVSEKVLHLRRLGMTYTGITERLGVNLWMAKKAARRGNIQKG*
Ga0137342_104753013300012171SoilRICWRAPSERIRTASEIPIEVNLTDEGAVPVYMKISEKVLHLRRLGMAYATIAERLKINLWMAKRAARWGKTHLKRRENTSPY*
Ga0137339_101445923300012673SoilMQGRWRAPSERIRTASEIPIEVDLTDEDAVPVYMKISEKVLHLRRLGMAYVTIAERLKINLWMAKRAARWGKTHLKRRENTSPY*
Ga0153916_1015445853300012964Freshwater WetlandsVAMGRGWRAPSERIRTASEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMTYTNIAERLGINPWMAKKAARWGNIRKG*
Ga0153916_1276528813300012964Freshwater WetlandsMERCGIREGGSNSLKWRAPSERIRTASEISIEMDLTDEDAIPIYMRISDKVLHLRRLGMTYTNIAQRLGINLWMAKKAAHWGRAH*
(restricted) Ga0172373_1010420523300013131FreshwaterLKWRAPSERIRTAAEIPIELDITDKDAVPIYIIIAEKIIHLRSLGMSYASICERLNVNRWMALKAVKWARTRPNNVTPRSGKKD*
(restricted) Ga0172372_1051129813300013132FreshwaterRIRTASEIPIEVELENEASVPVYMKISEKVLHLRRLGMPFADIADRLGVNLWMVKKAARWGRLH*
Ga0170573_1104965923300013232SedimentMKWRAPSERIRTASEIPIEMDLTGEDAIPIYMRISNKVLHLRRLGMTYTTIAERLGINPWMAKKAARWGNIQKG*
Ga0075326_102534043300014271Natural And Restored WetlandsLKRWRAPSERIRTASEIPIEVDLTDEDAAPAYMKVSEKVLHLRRLGMPYATIAERLKINLWMARKAARWGRTPHMGR*
Ga0075323_104921713300014301Natural And Restored WetlandsMLLLARPSERIRTASEILIEVELRDEASVPAYMKISEKVLHLRRLGMAYSKISEHLGVNLWMAKKAARWAKAQNK*
Ga0075322_100151363300014311Natural And Restored WetlandsSERIRTASEILIEVELRDEASVPAYMKISEKVLHLRRLGMAYSKISEHLGVNLWMAKKAARWAKAQNK*
Ga0180066_107143023300014873SoilMKWRAPSERIRTISEIPIEVELRDEASVPAYMKISEKVLHLRRLGMAYSKISEHLGVNLWMAKKAARWGNIQKA*
Ga0180083_100498453300014875SoilSERIRTTSEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMPFTSIAERLGINPWMAKKAARWGNIQKA*
Ga0180074_102477923300014877SoilLRWRAPSERIRTASEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMPFTSIAERLGINLWMAKKAARWGNIQKA*
Ga0180104_100921113300014884SoilMGGGWRAPSERIRTASEIPVDVDLTDEDAIPSYMKVSEKVLHLRRLGMSYTSIAERLKINLWM
Ga0180063_103373433300014885SoilCMKWRAPSERIRTASEIPVEVDLTDEDAVPTYMKISEKVLHLRRLGIPYAIIGERLGINRWLAMRAFRWAKDGYRKNQI*
Ga0180071_100421043300015249SoilLYVLRWCAQSERIRTASEIPIEVDLTDEDSIPIYMRISDKVLHLCRLGMPFTSIAERLGINPWMAKKAARWGNIQKA*
Ga0180072_106631913300015250SoilKERWRAPSERIRTASEIPIEVELRNENAIPAYRKVSEKVLHLRRLGMPYATIAERLKINPWMAKKAARWGNIQKA*
Ga0180072_107899223300015250SoilKWRAPSERIRTASEIPIEVDLKDEDAVPKYIKISENVLHLRRLGMAYATIAERLKINLWMAKRAARWGKTHLKRRENTSPY*
Ga0180081_101430323300015253SoilVQVVKKWLAPSESIRTASEIPIEVDLMDEDAIPIYMRISDKVLHLRRLGMTYTSIAEHLDVNIRMSKKAARWGNIQKA*
Ga0180089_101260923300015254SoilVDLTDEDAVPIYMKISEKVLHLRRLGMPYADIAKRLGVNVWMAKKAAGWGRIGRTAWTGLTHVSIRKIM*
Ga0180089_105613623300015254SoilMGREWRAPSERIRTASEIPIEVDLTNQDAVPAYMKISEKILHLRRLGMSYPCIAGRLGINVWMAKKAARCGKTHV*
Ga0180089_110304813300015254SoilMKWRAPSERIRTASEIPIVMDLTDKDAVPVYMKISEKVLHLRRLDMPYTIIAQRLGINLWMAKRAAHWAKTRKN*
Ga0180067_108611623300015257SoilMKWRAPSERIRTASEIPIEMDLTDEDAVPNYMKISEKVLHLRRLGMPYANIAERLGVNLWMTKKAARWGNIQKA*
Ga0184616_1021403623300018055Groundwater SedimentLDATKGKGWRAPSERIRTASEIPIEVELRDEASVPAYMKISEKVLHLRRLGMAYAKIAEHLGVNLWMAKRAVRWAKAHNK
Ga0184628_1070192413300018083Groundwater SedimentPSERIRTASEIPIEVDLTDEESVSVYMKISEKAFHLRRLGMTYADIAKRLGINPRMAKKAARWGNIQKA
Ga0184629_1009585333300018084Groundwater SedimentLRWRAPSERIRTASEIPIEVELRDGASVPVYMKISEKVLHLRRLGMPYPNIAERLGINPWMAKKAARWGNIQKV
Ga0206227_101281923300021063Deep Subsurface SedimentVATEKWRAPSERIRTASEIPIEVNPTDEDAIPVYIKISEKVLHLRRLGMPFTSIAERLGINPWMAKKAARWGNIQKA
Ga0209618_100144443300025001SoilLAICEVQEGSTNIEWRAPSERIRTASEIPIEVALTDEDAVPTYVKTTDKVLHLRRLGMTCASIAERLGINLWMAKRAARWAKTR
Ga0210022_103142533300025017AquiferERIRTASEIPIEVDLTDEDAIPIYMRISDKVLHLRRLGMPFTSIAEHLGINPWMAKKAARWGNIRKA
Ga0208246_100625443300025088SoilVRLAFESPGDRDGKRVARPERIRTASEIPIEVDLTDEDTIPIYMRISDKVLHLRRLGMTYTNIARPLGINPWMAKKAARWGNIQKG
Ga0209322_1003983513300025146SoilWRAPSERIRTASEIPIEVNLTDEDAVPVYMKISEKVLHLRRLGMTYAAIAERLGVNLWMAKRAACPPRRHHQG
Ga0209109_1037073313300025160SoilSERIRTASEIPIEVNLTDEDAIPVYIKISEKVLHLRRLGMPFTSIAERLGINPWMAKKAARWGNIQKA
Ga0209521_1016548013300025164SoilRTASEIPIEVELRDEASVPAYMKISEKVLHLRRLGMAYAKIAERLGVNLWMAEKAARYGKRHYSRQ
Ga0209521_1060079223300025164SoilRAPSERIRTASEIPIEVNLTDEDAVPTYMRISERVIHFRRLGMSYAAICGRLGVNRWMALSTVRWGKTRQMARNDYS
Ga0209642_1059631713300025167SoilMNQGVNWRAPSERIRTVSEIHIEVDLKDEDAVPTYVKIAGKVLHLRRLGMPYASICERLDVKRWMALRAVRWSKTRQMECGSEPLST
Ga0209002_1032026123300025289SoilTASEIPIEVDLTDKDAVPIYMKISEKVSHLGRLGMSYTSIADRLEINPWMAKKAARWGTISRKHRQDSLDRDA
Ga0209002_1069153613300025289SoilAPSERIRTVSEIHIEVDLKDEDAVPTYVKIAGKVLHLRRLGMPYASICERLDVKRWMALRAVRWSKTRQMECGSEPLST
Ga0209211_1006784813300025308SoilSPLESKWRAPSERIRTASEIPIEVNLTDEDAVPVYMKISEKVLHLRRLGMAYATIAERLKINLWMAKRAARWGNLQKS
Ga0209431_1058806513300025313SoilRWRAPSERIRTASEIAIEVDLTDEDAVPIYLKISEKVLHLCRLGMTFAGIAGHLGVNLWMAKKAARWGKIHHKG
Ga0209431_1069444613300025313SoilVNWRAPSERIRTVSEIHIEVDLKDEDAVPTYVKIAGKVLHLRRLGMPYASICERLDVKRWMALRAVRWSKTRQMECGSEPLST
Ga0209519_1028529023300025318SoilFWRAPSERIRTASEIPIEVDLTDKDAVPIYMKISEKVSHLGRLGMSYTSIADRLEINPWMAKKAARWGTISRKHRQDSLDRDA
Ga0209520_1015742613300025319SoilRAPSERIRTASEIPIEVELRDEASVPAYMKISEKVLHLRRLGMAYAKIAERLGVNLWMAEKAARYGKRHYSRQ
Ga0209640_1002102263300025324SoilLKWRAPSERIRTASEIPIEVNLTDEDAVPVYMKISEKVLHLRRLGMTYAAIAERLGVNVQMAKRANHWGKAHREKRKSPPHL
Ga0209640_1005439953300025324SoilMGWFESEWRAPSERIRTASEIPIEVDLMDADAIPLYMKVSEKVLHLRRLGMTYTNIAERLGINPWMAKKAARWGNIQKT
Ga0209341_1000332743300025325SoilLKWRAPSERIRTVSEIHIEVDLKDEDAVPTYVKIAGKVLHLRRLGMPYASICERLDVKRWMALRAVRWSKTRQMECGSEPLST
Ga0209342_1085174513300025326SoilMRWRAPSERIRTASEIPIEVDLTNVDAIPAYIRISEKVIHLRRLGMTYTSISERLGVNVWMAKRAACPPGRHHQE
Ga0209817_102158723300025524Arctic Peat SoilMEKWRVPSERIRTASEIPIEVDLTDKDAIPVYMRISDKVLHLHRLGMTYTNIAERLGINPWMAKKAARWGNIQKA
Ga0210115_101575223300025791Natural And Restored WetlandsMLLLARPSERIRTASEIPTGVELTNDVAIPISMSISDKVLRLRRLDMTYTNIAERLGINPWMAKKAARWGNTQKG
Ga0210113_108020323300025796Natural And Restored WetlandsMLLLARPSERIRTASEILIEVELRDEASVPAYMKISEKVLHLRRLGMAYSKISEHLGVNLWMAKKAARWAKAQNK
Ga0210078_100376433300025979Natural And Restored WetlandsLEKSWRTPSERIRTASEIPIEVELRDEDAIPIFMRISDKVLHLRRLGMTYTNIAERRGINPWMAKKAAQWGNIQQA
Ga0208420_101636913300026028Natural And Restored WetlandsSFIWRAPSERIRTASEIPIEVDLMNEDAVPIYMKISEKALHLRRLGMIYPNIAERLGINPWMAKKAARWGNTQKG
Ga0208912_102511123300026090Natural And Restored WetlandsLKWRAPSERIRTASEIPIEVDLMNEDAVPIYMKISEKALHLRRLGMTYPNIAERLGINPWMAKKAARWGNTQKG
Ga0209514_1001504823300027819GroundwaterVGSPAGGSNSLKWRALSERIRTASEIPIEVELRDENAIPVYMKISEKVLHLRRLGMPYPTIAERLRVNLWMAKKAARWGKIHHHH
Ga0209514_1019231123300027819GroundwaterLIGDLPVPTSPKPIPSEWLISSERIRAASEIPFEVDLTDEDAVPTYMRMSDKVLHLRRLGMTYANIGERLGVNLWMAKKAARWGNIQKG
Ga0209797_1031127413300027831Wetland SedimentSERIRTASEIPIEVDLTDEDAVPIYMKISEKVVHLRRLGMEYTKIAERLGVNPWMAKKAARWGNIQKG
Ga0209253_1114190723300027900Freshwater Lake SedimentPSGRIRTASEIPIEVDLTGEDAVPIYMKISEKVSHLRRLGMPYASIAERLEINLWMAKKAARWGKGQTGLTHMPTKRIM
Ga0265292_1009604103300028028Landfill LeachateIRTASEIPVEVDLQNEETVPIYMRISDKVLRLRRLGMPYANIAERLGVNLWMAKKAARWGNIQKG
Ga0265296_109439013300028032GroundwaterRPPHQRSDGASGQGGSNSLKWRAPSERIRTASEIPIEVDLTDEDAIQKYMEISEKALHLRRLGMAYAKIAERLGCNLWMAKKATRRGNPA
Ga0299915_1010852913300030613SoilYSREKWRAPSERIRTASDIPIEVDLTDEDSIPVYIIIAGKVLHLRRLGMSIASIAEHLGVNLWMAKRAARWGKIHHKG
Ga0315290_1015783053300031834SedimentSLKWRAPSERIRTASEIPIEVDLTDANAIPAYMKISEKVLHLRRLGMPYASIAERLGINLWMAKKAARWGIRNVRQPSPGVTLNLPS
Ga0315297_1012230253300031873SedimentMASGQGGSNCMKWRAPPERIRTASEIPLEVNLTDEDAVPIYMRISNKVLHLRRLGMTYTNIAERLGINPWMAKKAARWGNIQKG
Ga0315297_1102312713300031873SedimentGLEKSWRAPSERIRTASEIPIAVDLTDEDAIPAYMKISGKVLHLRRLGMGYIDIAEHLGVNLWMAKRAARWAKTHNK
Ga0214473_1001408233300031949SoilMARKLKTWRTPSERIRTASEIPTEVNPTDEDAVPGYMKISEKVLHLRRLGMPYTTIAERLGVNLWIAKKAARRGMSHPI
Ga0214473_1015707033300031949SoilMGKEWRAPSERIRTVSEIPIEVELRDQASVPAYMKVSEKVLHLRRLGITYPSIAERLGINPWMAKKAVRWRNIQQE
Ga0214473_1019878633300031949SoilMARPSERIRTASEIHIEVALTDEDAFPAYVKTSEKVLHLRRLGIAFPGIAERLGVNPGMAKKAARWGNTQKA
Ga0214473_1063677123300031949SoilVEWEKAGHHNKLKKWRAPSERIRTAAEIPIEVDLQDEDAIPNYMRISDKVLHLLRFGMTYTNIAEHLGINLWMAKKAARLGKTNQ
Ga0214473_1077103323300031949SoilSKWRAPSERIRTASEITIEVDLKDEDAVPTYVKISEKLLHLRRLGMDYDSICERLGINRWMVLRAIRWAKARDRNGKNGA
Ga0315278_1001284013300031997SedimentLKWRAPSERIRTASEIPIEVDLTDANAIPAYMKISEKVLHLRRLGMPYASIAERLGINLWMAKKAARWGIRNVRQPSPGVTLNLPS
Ga0315278_1079684713300031997SedimentRAPSERIRTASEIPIEVDLTDEDAVPVYMKISEKVLHLRRLGMPYASIAERLEVNLWMAKRAARWGKA
Ga0315268_1037443523300032173SedimentMKWRAPSERIRTASEIPIEVNLTDEDAIPVYIKISEKVLHLRRLGMPFTSIAERLGINPWMAKKAARWGKIQKA
Ga0315273_1039139433300032516SedimentIHIGKHAFFREKWRAPSERIRTASEIPFKVDLMDADAVPIYVKISEKVLHLRRLKMSYPCIAGRLGINVWMAKKAARWGKTHE
Ga0315273_1117885523300032516SedimentMGKGWRAPSERIRTASEIPIEVNLTDEDVIPVYIKISEKVLHLRRLGMTYTNIAERLGVNPWMAKKAARRGNIQKA
Ga0334722_1002252623300033233SedimentMEKRWRAPSERIRTASEIPIEVDLMDADAVPIYMKISEKVLHLRRLGMAYTSIAECLGVNLWMVKKAARWGKNCGNLSPRPIDLG
Ga0334722_1005378123300033233SedimentMEKRWRAPSERIRTASEIPIEVDLRDEDAVPIYMKISEKVLHLRQLGMTFTNICERMGINRWMALRAVRWAKGGLPKKAK
Ga0334722_1101355113300033233SedimentVKKKWRAPSERIRTASEIPIEVNLTDEDAIPVYRKISEKVLHLRRLGMPFTSIAERLGINPWMAKKAARWGNIQKA
Ga0316619_1148152723300033414SoilVVVKILRERWRAPSERIRTAAEIPIEMDLTDEDAIPAYMKVSEKVLHLRRLGMSYPSIADRLGINPWMAKKAARWGNIQKA
Ga0214471_10000967333300033417SoilMGGEWRAPSERIRTASEIPIEVELTDDDAVPVYMKISEKVLHLRRLGMPFTSIAERLGINPWMAKKAAWWGNTQKG
Ga0316628_10051607633300033513SoilLSEIPIEVDLTDKDAVPAYIRISEKVLHLHRLGMTYPSIAGRLGINVWMANRAARWGEHRLARLD
Ga0364930_0034096_47_2743300033814SedimentMEGWRAPSERIRTASEIPVEVNLTDEDAVPIYMKISEKVVHLRRLGMEYTKIAERLGVNPWMAKKAARWGNIQKA
Ga0364930_0192598_3_2423300033814SedimentRAPSERIRTASEIPTEVNLTDEGTVPVYMKISEKVLHLRRLGMAYATIAERLKINLWMAKRAARWGKTHLKRRENTSPY
Ga0364946_155000_285_5303300033815SedimentMRLVRLSNPLAAAMGKEWRAPSERIRTASEIPIEVDLTDEDAIPVYMKVSEKVLHLRRLGMSYTSIADRLGVNLWMAKRAAR
Ga0370498_015463_1122_13583300034155Untreated Peat SoilLVLRWRAPSERIRTASEIPIEVDLTDEESVPVYMKISEKAFHLRRLGMTYADIAKRLGVNLWMARKAARWGRTLHMGS
Ga0364942_0283520_2_2143300034165SedimentMLGRWRAPSERIRTASEIPVEVDLTDYDAVPIYMKISEKVLHLRRLRMPYATIAEHLKINLWMAQRAARWG
Ga0373907_053140_713_9313300034388Sediment SlurryKKWRAPSERIRTASEIPIVVALTDKDAVPTYVKTTDKVLHLRRLGMTYASIAECLGINLWMAKRAARWAKTR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.