3300025088: Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D2 (SPAdes)

Overview

Basic Information

• IMG/M Taxon OID: 3300025088
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053054 | Gp0055714 | Ga0208246
• Sample Name: Soil microbial communities from Rifle, Colorado - Rifle Oxygen_injection D2 (SPAdes)
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: Y
• Use Policy: Open

Dataset Contents

• Total Genome Size: 314404630
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Soil Microbial Communities From Rifle, Colorado, Usa
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Loam → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): terrestrial biome → land → soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Rifle, Colorado, United States
• Coordinates
  • Lat. (^o): 39.534762
  • Long. (^o): -107.782602
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056711	Metagenome / Metatranscriptome	137	Y
F069483	Metagenome / Metatranscriptome	124	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0208246_1006254	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	4556
Ga0208246_1014724	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	2588

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0208246_1006254	Ga0208246_10062544	F069483	VRLAFESPGDRDGKRVARPERIRTASEIPIEVDLTDEDTIPIYMRISDKVLHLRRLGMTYTNIARPLGINPWMAKKAARWGNIQKG
Ga0208246_1014724	Ga0208246_10147241	F056711	MRKAFTALAAAAFALSIVAGGCAKDKSPSQLQAGKKGIAGTEKKAAPKPRAKLFTGTIEDLDEAAGTLTLKGPKGEMSFQARKKVKEQLGELEIGDKVIVKHDG