| Basic Information | |
|---|---|
| Family ID | F041945 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 159 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MSPEQMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Number of Associated Samples | 143 |
| Number of Associated Scaffolds | 159 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 12.26 % |
| % of genes near scaffold ends (potentially truncated) | 83.65 % |
| % of genes from short scaffolds (< 2000 bps) | 89.31 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (55.975 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (25.157 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.673 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.912 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Mixed | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.07% β-sheet: 0.00% Coil/Unstructured: 54.93% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 159 Family Scaffolds |
|---|---|---|
| PF13276 | HTH_21 | 50.94 |
| PF13683 | rve_3 | 24.53 |
| PF13333 | rve_2 | 3.77 |
| PF00589 | Phage_integrase | 1.26 |
| PF00078 | RVT_1 | 1.26 |
| PF01527 | HTH_Tnp_1 | 1.26 |
| PF01471 | PG_binding_1 | 1.26 |
| PF12833 | HTH_18 | 0.63 |
| PF16859 | TetR_C_11 | 0.63 |
| PF00872 | Transposase_mut | 0.63 |
| PF13401 | AAA_22 | 0.63 |
| PF03739 | LptF_LptG | 0.63 |
| PF01028 | Topoisom_I | 0.63 |
| PF00665 | rve | 0.63 |
| PF00251 | Glyco_hydro_32N | 0.63 |
| PF03824 | NicO | 0.63 |
| PF08979 | DUF1894 | 0.63 |
| PF13481 | AAA_25 | 0.63 |
| COG ID | Name | Functional Category | % Frequency in 159 Family Scaffolds |
|---|---|---|---|
| COG0795 | Lipopolysaccharide export LptBFGC system, permease protein LptF | Cell wall/membrane/envelope biogenesis [M] | 0.63 |
| COG1621 | Sucrose-6-phosphate hydrolase SacC, GH32 family | Carbohydrate transport and metabolism [G] | 0.63 |
| COG2152 | Predicted glycosyl hydrolase, GH43/DUF377 family | Carbohydrate transport and metabolism [G] | 0.63 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.63 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.63 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.63 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.63 |
| COG3507 | Beta-xylosidase | Carbohydrate transport and metabolism [G] | 0.63 |
| COG3569 | DNA topoisomerase IB | Replication, recombination and repair [L] | 0.63 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 55.97 % |
| Unclassified | root | N/A | 44.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090014|GPIPI_16582349 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300001108|JGI12647J13326_100519 | All Organisms → cellular organisms → Bacteria | 1248 | Open in IMG/M |
| 3300001141|JGI12638J13249_101048 | Not Available | 969 | Open in IMG/M |
| 3300001155|JGI12625J13251_10507 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300001636|JGI20236J16297_102047 | Not Available | 548 | Open in IMG/M |
| 3300001867|JGI12627J18819_10071758 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
| 3300001867|JGI12627J18819_10345221 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300001904|JGI24736J21556_1047039 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100535136 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300002954|JGI20281J44786_102771 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300004092|Ga0062389_102269441 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300005338|Ga0068868_100347602 | All Organisms → cellular organisms → Bacteria | 1269 | Open in IMG/M |
| 3300005437|Ga0070710_10383940 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300005468|Ga0070707_100168456 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2134 | Open in IMG/M |
| 3300005552|Ga0066701_10409754 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300005555|Ga0066692_10337468 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300005556|Ga0066707_10347076 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300005764|Ga0066903_103459050 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005843|Ga0068860_100452129 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → Verrucomicrobium → unclassified Verrucomicrobium → Verrucomicrobium sp. 3C | 1277 | Open in IMG/M |
| 3300006059|Ga0075017_100985309 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006173|Ga0070716_101490783 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006755|Ga0079222_11613110 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006914|Ga0075436_101384719 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 533 | Open in IMG/M |
| 3300007258|Ga0099793_10345247 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300007643|Ga0104854_11200687 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009090|Ga0099827_10881585 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300009101|Ga0105247_10149519 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300010046|Ga0126384_12302981 | Not Available | 520 | Open in IMG/M |
| 3300010234|Ga0136261_1056244 | Not Available | 845 | Open in IMG/M |
| 3300010343|Ga0074044_10599550 | Not Available | 719 | Open in IMG/M |
| 3300010358|Ga0126370_10396345 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300010361|Ga0126378_10308709 | Not Available | 1686 | Open in IMG/M |
| 3300010376|Ga0126381_100098101 | Not Available | 3733 | Open in IMG/M |
| 3300011119|Ga0105246_10155354 | Not Available | 1737 | Open in IMG/M |
| 3300012098|Ga0153966_111668 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptospira | 615 | Open in IMG/M |
| 3300012180|Ga0153974_1119178 | Not Available | 607 | Open in IMG/M |
| 3300012189|Ga0137388_11241267 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300012202|Ga0137363_11515538 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012203|Ga0137399_10548870 | Not Available | 971 | Open in IMG/M |
| 3300012361|Ga0137360_10243994 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1472 | Open in IMG/M |
| 3300012361|Ga0137360_11381674 | Not Available | 607 | Open in IMG/M |
| 3300012582|Ga0137358_10020629 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4241 | Open in IMG/M |
| 3300012917|Ga0137395_10205891 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
| 3300012917|Ga0137395_11002006 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300012924|Ga0137413_10252892 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300012929|Ga0137404_11465294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 631 | Open in IMG/M |
| 3300012976|Ga0134076_10069377 | Not Available | 1360 | Open in IMG/M |
| 3300012985|Ga0164308_10289429 | Not Available | 1296 | Open in IMG/M |
| 3300014325|Ga0163163_10371801 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
| 3300015053|Ga0137405_1121581 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2604 | Open in IMG/M |
| 3300015053|Ga0137405_1143405 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
| 3300015192|Ga0167646_1047929 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300015200|Ga0173480_11072463 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300016270|Ga0182036_10025910 | Not Available | 3421 | Open in IMG/M |
| 3300016445|Ga0182038_10372623 | Not Available | 1189 | Open in IMG/M |
| 3300017966|Ga0187776_10623417 | Not Available | 754 | Open in IMG/M |
| 3300017972|Ga0187781_11168175 | Not Available | 566 | Open in IMG/M |
| 3300017975|Ga0187782_10335674 | Not Available | 1143 | Open in IMG/M |
| 3300018064|Ga0187773_10970547 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300019890|Ga0193728_1144818 | Not Available | 1051 | Open in IMG/M |
| 3300020048|Ga0207193_1590568 | Not Available | 738 | Open in IMG/M |
| 3300020582|Ga0210395_11305049 | Not Available | 531 | Open in IMG/M |
| 3300021171|Ga0210405_10114618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 2129 | Open in IMG/M |
| 3300021178|Ga0210408_10352430 | Not Available | 1173 | Open in IMG/M |
| 3300021388|Ga0213875_10204667 | Not Available | 928 | Open in IMG/M |
| 3300021406|Ga0210386_10852665 | All Organisms → cellular organisms → Bacteria | 781 | Open in IMG/M |
| 3300021432|Ga0210384_10101534 | All Organisms → cellular organisms → Bacteria | 2580 | Open in IMG/M |
| 3300021444|Ga0213878_10301582 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → unclassified Opitutae → Opitutae bacterium Tous-C8FEB | 687 | Open in IMG/M |
| 3300021444|Ga0213878_10422656 | Not Available | 581 | Open in IMG/M |
| 3300023311|Ga0256681_10768010 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| (restricted) 3300024054|Ga0233425_10436006 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300025898|Ga0207692_10068053 | Not Available | 1866 | Open in IMG/M |
| 3300025905|Ga0207685_10109521 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300025910|Ga0207684_10011505 | All Organisms → cellular organisms → Bacteria | 7733 | Open in IMG/M |
| 3300025910|Ga0207684_10102486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2447 | Open in IMG/M |
| 3300025922|Ga0207646_10080783 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
| 3300025922|Ga0207646_11538714 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300025981|Ga0207640_10168258 | Not Available | 1630 | Open in IMG/M |
| 3300026331|Ga0209267_1196202 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300026359|Ga0257163_1013181 | Not Available | 1257 | Open in IMG/M |
| 3300026359|Ga0257163_1056283 | Not Available | 629 | Open in IMG/M |
| 3300026361|Ga0257176_1009842 | Not Available | 1235 | Open in IMG/M |
| 3300026371|Ga0257179_1007026 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300026446|Ga0257178_1034329 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026481|Ga0257155_1026741 | Not Available | 848 | Open in IMG/M |
| 3300026482|Ga0257172_1051413 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300026490|Ga0257153_1025354 | Not Available | 1220 | Open in IMG/M |
| 3300026496|Ga0257157_1028811 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300026498|Ga0257156_1024223 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300026721|Ga0208841_104789 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026810|Ga0207801_108610 | Not Available | 644 | Open in IMG/M |
| 3300026872|Ga0207785_1017161 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300026911|Ga0209620_1003635 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300027061|Ga0209729_1011922 | Not Available | 994 | Open in IMG/M |
| 3300027071|Ga0209214_1023222 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300027371|Ga0209418_1009484 | Not Available | 1501 | Open in IMG/M |
| 3300027548|Ga0209523_1103257 | Not Available | 590 | Open in IMG/M |
| 3300027565|Ga0209219_1102109 | Not Available | 706 | Open in IMG/M |
| 3300027610|Ga0209528_1044066 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300027703|Ga0207862_1123859 | Not Available | 776 | Open in IMG/M |
| 3300027874|Ga0209465_10646204 | Not Available | 521 | Open in IMG/M |
| 3300027903|Ga0209488_10298539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1203 | Open in IMG/M |
| 3300027908|Ga0209006_11026637 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300027908|Ga0209006_11128779 | Not Available | 617 | Open in IMG/M |
| 3300028047|Ga0209526_10609968 | Not Available | 698 | Open in IMG/M |
| 3300028196|Ga0257114_1120520 | Not Available | 1043 | Open in IMG/M |
| 3300028381|Ga0268264_10363124 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
| 3300028906|Ga0308309_11622529 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300030872|Ga0265723_1002239 | Not Available | 926 | Open in IMG/M |
| 3300031546|Ga0318538_10117894 | Not Available | 1384 | Open in IMG/M |
| 3300031547|Ga0310887_10244581 | Not Available | 998 | Open in IMG/M |
| 3300031564|Ga0318573_10412921 | Not Available | 725 | Open in IMG/M |
| 3300031572|Ga0318515_10365253 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300031573|Ga0310915_10568237 | Not Available | 804 | Open in IMG/M |
| 3300031576|Ga0247727_10580922 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031679|Ga0318561_10114543 | Not Available | 1428 | Open in IMG/M |
| 3300031715|Ga0307476_10703892 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300031718|Ga0307474_10212067 | Not Available | 1476 | Open in IMG/M |
| 3300031718|Ga0307474_11036103 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031720|Ga0307469_10437015 | Not Available | 1129 | Open in IMG/M |
| 3300031720|Ga0307469_11221178 | Not Available | 711 | Open in IMG/M |
| 3300031720|Ga0307469_12071612 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300031744|Ga0306918_10318595 | Not Available | 1201 | Open in IMG/M |
| 3300031747|Ga0318502_10365451 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300031777|Ga0318543_10477144 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300031792|Ga0318529_10196029 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031793|Ga0318548_10161119 | Not Available | 1095 | Open in IMG/M |
| 3300031799|Ga0318565_10622491 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031820|Ga0307473_10938407 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 627 | Open in IMG/M |
| 3300031821|Ga0318567_10151024 | Not Available | 1284 | Open in IMG/M |
| 3300031831|Ga0318564_10545629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 502 | Open in IMG/M |
| 3300031859|Ga0318527_10485969 | Not Available | 527 | Open in IMG/M |
| 3300031879|Ga0306919_10259189 | Not Available | 1310 | Open in IMG/M |
| 3300031880|Ga0318544_10206279 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300031880|Ga0318544_10254921 | Not Available | 679 | Open in IMG/M |
| 3300031897|Ga0318520_10158038 | Not Available | 1318 | Open in IMG/M |
| 3300031910|Ga0306923_10022312 | Not Available | 6718 | Open in IMG/M |
| 3300031910|Ga0306923_11472994 | Not Available | 713 | Open in IMG/M |
| 3300031912|Ga0306921_10358092 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
| 3300031941|Ga0310912_10883065 | Not Available | 688 | Open in IMG/M |
| 3300031947|Ga0310909_10197931 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → unclassified Planctomyces → Planctomyces sp. SH-PL62 | 1669 | Open in IMG/M |
| 3300031954|Ga0306926_11737244 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300032010|Ga0318569_10176261 | Not Available | 988 | Open in IMG/M |
| 3300032035|Ga0310911_10871484 | Not Available | 520 | Open in IMG/M |
| 3300032043|Ga0318556_10320563 | Not Available | 810 | Open in IMG/M |
| 3300032076|Ga0306924_10811859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1042 | Open in IMG/M |
| 3300032091|Ga0318577_10503755 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300032205|Ga0307472_101530706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Bradymonadales → Bradymonadaceae → Persicimonas → Persicimonas caeni | 652 | Open in IMG/M |
| 3300032261|Ga0306920_100013888 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 10983 | Open in IMG/M |
| 3300032261|Ga0306920_101997147 | Not Available | 812 | Open in IMG/M |
| 3300032783|Ga0335079_11437187 | Not Available | 683 | Open in IMG/M |
| 3300033289|Ga0310914_10697226 | Not Available | 911 | Open in IMG/M |
| 3300033289|Ga0310914_11564511 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300033290|Ga0318519_10578737 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300034095|Ga0335022_0254388 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 25.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 12.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.92% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.66% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.77% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.52% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.26% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 1.26% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.26% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.26% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 1.26% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.63% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.63% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.63% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.63% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.63% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.63% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.63% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.63% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.63% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.63% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.63% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.63% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.63% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.63% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.63% |
| Biofilm Marine Aquaculture Plant | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Biofilm Marine Aquaculture Plant | 0.63% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001108 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 | Environmental | Open in IMG/M |
| 3300001141 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 | Environmental | Open in IMG/M |
| 3300001155 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 | Environmental | Open in IMG/M |
| 3300001636 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Host-Associated | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002954 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007643 | Biofilm microbial communities from a marine aquaculture plant in North Sea, Germany | Engineered | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010234 | Freshwater aquifer microbial community from Bangor, North Wales, UK, before enrichment, replicate 2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012098 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL050 MetaG | Host-Associated | Open in IMG/M |
| 3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Host-Associated | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
| 3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
| 3300024054 (restricted) | Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MG | Environmental | Open in IMG/M |
| 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026446 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-B | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026482 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-B | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300026721 | Forest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN395 (SPAdes) | Environmental | Open in IMG/M |
| 3300026810 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 (SPAdes) | Environmental | Open in IMG/M |
| 3300026872 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 74 (SPAdes) | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027061 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028196 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10m | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030872 | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPIPI_02731020 | 2088090014 | Soil | EQMVEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| JGI10216J12902_1034527812 | 3300000956 | Soil | QAPAEIEGEMKSPEEMAQIIRQQHKEIEYLKKQREILKKAMSILGEEPNPGMR* |
| JGI12647J13326_1005191 | 3300001108 | Forest Soil | TIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR* |
| JGI12638J13249_1010481 | 3300001141 | Forest Soil | EEMLEKIRQQQSEIEYLRRQREILKKAMSILGEEPHNGMR* |
| JGI12625J13251_105071 | 3300001155 | Forest Soil | EMFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR* |
| JGI20236J16297_1020472 | 3300001636 | Forest Soil | EQMSPEQMVEKIRQQQKEIEYLKRQREILKKAMSILGEEPHSGMR* |
| JGI12627J18819_100717582 | 3300001867 | Forest Soil | MSPEEMLEKIRQQQNEIEYLKRQREILKKAMSILGEEPHSGMR* |
| JGI12627J18819_103452211 | 3300001867 | Forest Soil | PAEIDGEIKSPEEMAKIIRDQHREIEYLKRQREILKKAMSILGEEPNPGMR* |
| JGI24736J21556_10470391 | 3300001904 | Corn Rhizosphere | PAEIDGRQRTPEQMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR* |
| JGIcombinedJ26739_1005351362 | 3300002245 | Forest Soil | EQMVAEIKRQQKEIEYLKRQREILKKAMSILGEEPNPGMR* |
| JGI20281J44786_1027711 | 3300002954 | Forest Soil | HLKPAQFDGEQMSPEQMVEKIRQQQKEIEYLKRQREILKKAMSILGEEPHSGMR* |
| JGIcombinedJ51221_102957761 | 3300003505 | Forest Soil | RQQAPAQIDGQQRSPEQMVAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0062389_1022694411 | 3300004092 | Bog Forest Soil | VRPGQLDGKQMSPEQMLEKIRQQQSEIEYLKRQREILKKATSILGEEPHRGMR* |
| Ga0068868_1003476022 | 3300005338 | Miscanthus Rhizosphere | PEQMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0070710_103839401 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | QMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0070707_1001684561 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | QLKPGELEGKPLSPEEMLETIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0066701_104097541 | 3300005552 | Soil | IRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0066692_103374681 | 3300005555 | Soil | LSPEQMVEKIRQQQKEIEFLKRQREILKKAMSILGEEPHSGMR* |
| Ga0066707_103470761 | 3300005556 | Soil | SPEQMVEKIRQQQKEIEFLKRQREILKKAMSILGEEPHSGMR* |
| Ga0066903_1034590501 | 3300005764 | Tropical Forest Soil | LEKIRQQQSEIEYLKRQREILKKAMSILGEEPHSGMR* |
| Ga0068860_1004521291 | 3300005843 | Switchgrass Rhizosphere | IRRLNRENEYLRRQREILKKAMSILGEESAPGLR* |
| Ga0075017_1009853093 | 3300006059 | Watersheds | KSPEEMAKIIREQHKEIEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0070716_1014907832 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0079222_116131102 | 3300006755 | Agricultural Soil | EQMAVEIRRLNKENEYLRRQREILKKAMSIVGEEPSPGMR* |
| Ga0075436_1013847191 | 3300006914 | Populus Rhizosphere | EGKPLSPEEMFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0099793_103452473 | 3300007258 | Vadose Zone Soil | PEQMAQTIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0104854_112006871 | 3300007643 | Biofilm Marine Aquaculture Plant | SPERMYREIKRLQEENRYLMRQREILKKAMSILGESPQTNMR* |
| Ga0099827_108815851 | 3300009090 | Vadose Zone Soil | PEQMVAEIKRQQKEIEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0105247_101495191 | 3300009101 | Switchgrass Rhizosphere | QMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNETPPI* |
| Ga0126384_123029812 | 3300010046 | Tropical Forest Soil | MSPEEMLEKIRQQQSEIEYLKRQRQILKKAMSILGEEPHNGMR* |
| Ga0136261_10562441 | 3300010234 | Freshwater | LLPEIKRLKKENEYLRRQREILKKAASIISENPELGMR* |
| Ga0074044_105995502 | 3300010343 | Bog Forest Soil | VRPGQLDGEQMSPEEMLEKIRQQQSEIEYLKRQREILKKAMSILGEEPQSGMR* |
| Ga0126370_103963451 | 3300010358 | Tropical Forest Soil | MVEKIRQQQKEIEYLKRQREILKKAMSILGEEPHSGMR* |
| Ga0126378_103087092 | 3300010361 | Tropical Forest Soil | MKNPEEMAKIIREQHKEIEYLKRQREILKKAMSILGEEPTNGMR* |
| Ga0126381_1000981011 | 3300010376 | Tropical Forest Soil | GGGGLSPEQLVDKIRQLQKENEYLKRQREILKKAMSILGEEPSSGMR* |
| Ga0105246_101553541 | 3300011119 | Miscanthus Rhizosphere | EIDGRQRTPEQMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0153966_1116682 | 3300012098 | Attine Ant Fungus Gardens | LDGEQMSPEEMLEKIRQQQGEIEYLKRQREILKKAMSILGEEPHSGMR* |
| Ga0153974_11191781 | 3300012180 | Attine Ant Fungus Gardens | VEKNDQLEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0137388_112412672 | 3300012189 | Vadose Zone Soil | MSPEQMVAEIKRQQKEIEYLRRQREILKKAMSILGEEPNTGMR* |
| Ga0137363_115155383 | 3300012202 | Vadose Zone Soil | EGKPLSPEEMLETIRQLQKENEYLKRQREILKKALSIVGEEPNPGMR* |
| Ga0137399_105488702 | 3300012203 | Vadose Zone Soil | MAQTIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGM |
| Ga0137360_102439943 | 3300012361 | Vadose Zone Soil | MSPEQMVAEIKRQHKEIEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0137360_113816741 | 3300012361 | Vadose Zone Soil | PAQLGSRQMSPEQMVAEIKRQQKEIEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0137358_100206296 | 3300012582 | Vadose Zone Soil | LKPGELEGKPLSPEEMFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0137395_102058911 | 3300012917 | Vadose Zone Soil | QLGFRQMSTEQMVAEIKRQQKEIEYLRRQREILKKAMSILGEEPNTGMR* |
| Ga0137395_110020062 | 3300012917 | Vadose Zone Soil | LSQVDLIFVKRMSPEEMVEKIRQLQKENEYLKRQREIFKKAMSILGEEPNPGMR* |
| Ga0137413_102528922 | 3300012924 | Vadose Zone Soil | MAQTIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0137404_114652941 | 3300012929 | Vadose Zone Soil | EQMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR* |
| Ga0134076_100693771 | 3300012976 | Grasslands Soil | QMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR* |
| Ga0164308_102894291 | 3300012985 | Soil | IDGRQRTPEQMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0163163_103718011 | 3300014325 | Switchgrass Rhizosphere | AEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR* |
| Ga0137405_11215813 | 3300015053 | Vadose Zone Soil | EMVEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0137405_11434054 | 3300015053 | Vadose Zone Soil | PGQIDGQQQSPEQMAQTIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR* |
| Ga0167646_10479292 | 3300015192 | Glacier Forefield Soil | ADAAGEIRRLHREVEYLRRQREILKKAMSILSEEPPSGMR* |
| Ga0173480_110724631 | 3300015200 | Soil | KVDGRELTPVQMSQEIRRLQKENEYLKRQREILKKAMSILGEEPTGSMR* |
| Ga0182036_100259101 | 3300016270 | Soil | NGEQMSPEEMLEKIHQQQSEIEYLKRQREILKKAMSILGEETHNGMR |
| Ga0182038_103726231 | 3300016445 | Soil | KIHQQQSEIEYLKRQREILKKAMSILGEETHNGMR |
| Ga0187776_106234172 | 3300017966 | Tropical Peatland | EEMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0187781_111681751 | 3300017972 | Tropical Peatland | IKSPEEMAKIIREQHQEIEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0187782_103356742 | 3300017975 | Tropical Peatland | EIKSPEEMAKIIREQHQEIEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0187773_109705472 | 3300018064 | Tropical Peatland | MGPEEMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0193728_11448182 | 3300019890 | Soil | QRSPEQMVAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0207193_15905682 | 3300020048 | Freshwater Lake Sediment | XVEPAAEIRRLQRENEYLRRQREILKKAMSILSEVPLSGMP |
| Ga0210395_113050491 | 3300020582 | Soil | AEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0210405_101146181 | 3300021171 | Soil | MEPAQLGSGQMSPEQMVAEIKRQQKEIEYLRRQREILKKAMSILGEEPNTGIR |
| Ga0210408_103524301 | 3300021178 | Soil | PEQMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0213875_102046672 | 3300021388 | Plant Roots | EIEGQMKSPEEMAKIIREQHKEIEYLKRQREILKKAMSILGEEPSNGMR |
| Ga0210386_108526653 | 3300021406 | Soil | FAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0210384_101015341 | 3300021432 | Soil | PGELEGEQLSPKEMFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0213878_103015821 | 3300021444 | Bulk Soil | MKPAKIAGEIKSPEEMAKIIREQHKEIEYLKRQREIQKKAMSILGGRTE |
| Ga0213878_104226562 | 3300021444 | Bulk Soil | GEMKSPEEMAKIIREQHKEIEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0256681_107680101 | 3300023311 | Freshwater | PLADPAGEIRRLQREVEYLRRQREILKKAVSILSEEPHSGMR |
| (restricted) Ga0233425_104360062 | 3300024054 | Freshwater | IGDVAAELRRLHKENEYLKRQREILKKALSILSEDPQSGMR |
| Ga0207696_10475902 | 3300025711 | Switchgrass Rhizosphere | LRQQAPAEIDGRQRTPEQMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0207692_100680531 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | TIKQQQREIEYLRRQREILKKAMSILGEEPNPGMR |
| Ga0207685_101095212 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | PEEMLETIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0207684_100115055 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSPEEMAEIIRQQHKEIEYLKKQREILKKAMSILGEEPNPGMR |
| Ga0207684_101024861 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | PEEMFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0207646_100807835 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | QLKPGELEGKPLSPEEMLETIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0207646_115387142 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0207640_101682582 | 3300025981 | Corn Rhizosphere | MFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0209267_11962022 | 3300026331 | Soil | AQTIRQLYKEVEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0257163_10131812 | 3300026359 | Soil | QMAQTIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0257163_10562831 | 3300026359 | Soil | AEIRRLQKENEYLKRQREILKKAMSILGEGPNPGMR |
| Ga0257176_10098421 | 3300026361 | Soil | GGEQLNSEQLVDKIRQQHKEIEYLKRQREILKKAMSILGEEPNNGMR |
| Ga0257179_10070262 | 3300026371 | Soil | PVEMAAEIRRQHKEIEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0257178_10343291 | 3300026446 | Soil | ADQKPAKIDQREMNPVEMAAEIRRQHKEIEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0257155_10267412 | 3300026481 | Soil | MAQTIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0257172_10514131 | 3300026482 | Soil | MFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0257153_10253542 | 3300026490 | Soil | EGKPLSPEEMVEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0257157_10288113 | 3300026496 | Soil | SPEEMLETIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0257156_10242231 | 3300026498 | Soil | GKPLSPEEMVEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0208841_1047892 | 3300026721 | Soil | FETIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0207801_1086101 | 3300026810 | Tropical Forest Soil | LGSRQMSPEQMVAEIKRQQKEIEYLRRQREILKKAMSILGEEPNTGMR |
| Ga0207785_10171611 | 3300026872 | Tropical Forest Soil | PAQLDGEQMGPEEMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0209620_10036351 | 3300026911 | Forest Soil | EELVATIKQQQKEIEYLRRQREILKKAVSILGEEPNPGMR |
| Ga0209729_10119221 | 3300027061 | Forest Soil | GQQMSAEQMAVEIRRLNKENEYLRRQREILKKAMSIVGEEPSPGMR |
| Ga0209214_10232222 | 3300027071 | Forest Soil | PGQLDGEQMSPEQMFKKIREQQKEIEYLKRQREILKKAMSILGEEPNSGMR |
| Ga0209418_10094842 | 3300027371 | Forest Soil | MLEKIRQQQNEIEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0209004_10409112 | 3300027376 | Forest Soil | LRDVRPAELNGEQMSPEEMLEKIRQQQNEIEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0209523_11032572 | 3300027548 | Forest Soil | SPEQMVAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0209219_11021092 | 3300027565 | Forest Soil | AQLGSSQMSPEQMVAEIKRQQKEIEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0209528_10440661 | 3300027610 | Forest Soil | TIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0207862_11238592 | 3300027703 | Tropical Forest Soil | DGEQMGPEQMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0209465_106462042 | 3300027874 | Tropical Forest Soil | KIRQQQKEIEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0209488_102985393 | 3300027903 | Vadose Zone Soil | QIDGQQQSPEQMAQTIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0209006_110266371 | 3300027908 | Forest Soil | PVADAAAEIRRLQRENEYLRRQREILKKAMSILSEDPQSGMR |
| Ga0209006_111287793 | 3300027908 | Forest Soil | MEPAQLGSRQMSPEQMVAEIKRQQKEIEYLRRQREILKKAMSILGEEPNTGMR |
| Ga0209526_106099681 | 3300028047 | Forest Soil | MSPEQMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0257114_11205202 | 3300028196 | Marine | SAKELWDENQKLKRENAYLKRQREILKKAASILAEDPQLGMR |
| Ga0268264_103631242 | 3300028381 | Switchgrass Rhizosphere | LTPEEAFVEIRRLNRENEYLRRQREILKKAMSILGEESAPGLR |
| Ga0308309_116225292 | 3300028906 | Soil | AQRIRQLHKEVEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0265723_10022391 | 3300030872 | Soil | QQRSPEQMLAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0318538_101178943 | 3300031546 | Soil | VKPAQLDGEQMNPEQMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHNGMR |
| Ga0310887_102445811 | 3300031547 | Soil | RTPEQMFAEIRRLQKENEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0318573_104129211 | 3300031564 | Soil | AELNGEQMSPEEMLEKIHQQQSEIEYLKRQREILKKAMSILGEEPHNGMR |
| Ga0318515_103652531 | 3300031572 | Soil | AQLDGQQLSPEQMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0310915_105682371 | 3300031573 | Soil | EKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0247727_105809222 | 3300031576 | Biofilm | LEADNRQLRKDLEYVKRQREILKKAMSILGEEPTGGMR |
| Ga0318561_101145432 | 3300031679 | Soil | VRPAELNGEQMSPEEMLEKIHQQQSEIEYLKRQREILKKAMSILGEEPHNGMR |
| Ga0307476_107038921 | 3300031715 | Hardwood Forest Soil | MEPPQQGSRQMSLEQMVAEIKRQQKEIEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0307474_102120673 | 3300031718 | Hardwood Forest Soil | MAKIIQEQHKEIEYLKRQREILKKAMSILGEEPPNGMR |
| Ga0307474_110361031 | 3300031718 | Hardwood Forest Soil | ATIKQQQKEIEYLRRQREILKKAMSILGEEPNPGMR |
| Ga0307469_104370152 | 3300031720 | Hardwood Forest Soil | LSPEEMLETIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0307469_112211782 | 3300031720 | Hardwood Forest Soil | DGEQMSPEQMVEKIRQQQKEIEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0307469_120716122 | 3300031720 | Hardwood Forest Soil | LEGKPLSPEEMFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0306918_103185951 | 3300031744 | Soil | QMSPEEMLEKIHQQQSEIEYLKRQREILKKAMSILGEETHNGMR |
| Ga0318502_103654511 | 3300031747 | Soil | EKIHQQQSEIEYLKRQREILKKAMSILGEEPHNGMR |
| Ga0318543_104771442 | 3300031777 | Soil | DGEQMNPEQMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHNGMR |
| Ga0318529_101960292 | 3300031792 | Soil | ELRSELRRLQKENEVLKRQRDILKKAMSILGEEPSSGMR |
| Ga0318548_101611192 | 3300031793 | Soil | NGEQMSPEEMLEKIRQQQSEIEYLKRQREILKKAMSILGEEPHNGMR |
| Ga0318565_106224912 | 3300031799 | Soil | GQLDGEQLSPEQMVEKIRQQQKEIEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0307473_109384071 | 3300031820 | Hardwood Forest Soil | LEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0318567_101510241 | 3300031821 | Soil | PEEMLEKIRQQQSEIEYLKRQREILKKAMSILGEEPRSGMR |
| Ga0318564_105456292 | 3300031831 | Soil | AELNGEQMSPEEMLEKIRQQQSEIEYLKRQREILKKAMSILGEEPRSGMR |
| Ga0318527_104859691 | 3300031859 | Soil | EQMSPEEMLEKIRQQQSEIEYLKRQREILKKAMSILGEEPRSGMR |
| Ga0306919_102591891 | 3300031879 | Soil | AEIGGEGLSPEQLVDKIRQLQKENEYLKRQREILKKAMSILGEEPSSGMR |
| Ga0318544_102062791 | 3300031880 | Soil | ELRRLQKENEVLKRQRDILKKAMSILGEEPSSGMR |
| Ga0318544_102549212 | 3300031880 | Soil | PEQMLEKIRQLQSENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0318520_101580381 | 3300031897 | Soil | RVKPAQLDGEQMNPEQMLEKIRQLQKENEYLKRQREILKKAMGILGEEPHNGMR |
| Ga0306923_1002231210 | 3300031910 | Soil | LNGEQMSPEEMLEKIHQQQSEIEYLKRQREILKKAMSILGEETHNGMR |
| Ga0306923_114729941 | 3300031910 | Soil | LNGEQMSPEEMLEKIHQQQSEIEYLKRQREILKKAMSILGEEPHNGMR |
| Ga0306921_103580921 | 3300031912 | Soil | QMLEKIRQLQSENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0310912_108830651 | 3300031941 | Soil | LDGEQLSPEQMLEKIRQLQSENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0310909_101979311 | 3300031947 | Soil | EEMLEKIHQQQSEIEYLKRQREILKKAMSILGEETHNGMR |
| Ga0306926_117372441 | 3300031954 | Soil | KSPGEMAKIIREQHKEIEYLKRQREILEKAMSILGEEPNPGMR |
| Ga0318569_101762611 | 3300032010 | Soil | PEEMLEKIRQQQSEIEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0310911_108714842 | 3300032035 | Soil | MLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0318556_103205632 | 3300032043 | Soil | MSPEEMLEKIHQQQSEIEYLKRQREILKKAMSILGEEPHNGMR |
| Ga0306924_108118593 | 3300032076 | Soil | AENRRLHKENEALIRQREILKKAMCILGEEPGTGMR |
| Ga0318577_105037551 | 3300032091 | Soil | PEEMVKIIREQHKEIEYLKRQREILKKAMSILGEEPSSGMR |
| Ga0307472_1015307062 | 3300032205 | Hardwood Forest Soil | EGKQLSPEEMFEKIRQLQKENEYLKRQREILKKAMSIVGEEPNPGMR |
| Ga0306920_10001388816 | 3300032261 | Soil | AELKGEQMSPEEMLEKIHQQQSEIEYLKRQREILKKAMSILGEETHNGMR |
| Ga0306920_1019971472 | 3300032261 | Soil | DGEQLSPEQMVEKIRQQQKEIEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0335079_114371871 | 3300032783 | Soil | EEMAKIIREQHKEIEYLKRQREILKKAMSILGEEPNPGMR |
| Ga0310914_106972261 | 3300033289 | Soil | MLDEIRQLQKENDYLKRQREIVKKAMSILGEEPHSGMR |
| Ga0310914_115645112 | 3300033289 | Soil | SPEQMVAEIKRQQKEIEYLRRQREILKKAMSILGEEPNTGMR |
| Ga0318519_105787372 | 3300033290 | Soil | QLDGEQMGPEEMLEKIRQLQKENEYLKRQREILKKAMSILGEEPHSGMR |
| Ga0335022_0254388_816_938 | 3300034095 | Freshwater | VEPAAEIRRLQRENEYLRRQREILKKAMSILSEVPLSGMP |
| ⦗Top⦘ |