NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F041807

Metagenome / Metatranscriptome Family F041807

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F041807
Family Type Metagenome / Metatranscriptome
Number of Sequences 159
Average Sequence Length 56 residues
Representative Sequence MARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLK
Number of Associated Samples 137
Number of Associated Scaffolds 159

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.92 %
% of genes near scaffold ends (potentially truncated) 98.11 %
% of genes from short scaffolds (< 2000 bps) 76.73 %
Associated GOLD sequencing projects 130
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.358 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(39.623 % of family members)
Environment Ontology (ENVO) Unclassified
(39.623 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(75.472 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.73%    β-sheet: 30.91%    Coil/Unstructured: 36.36%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 159 Family Scaffolds
PF00203Ribosomal_S19 56.60
PF03947Ribosomal_L2_C 25.79
PF00276Ribosomal_L23 5.66
PF00573Ribosomal_L4 5.03
PF00297Ribosomal_L3 3.77
PF00118Cpn60_TCP1 1.26
PF00012HSP70 1.26
PF00238Ribosomal_L14 0.63

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 159 Family Scaffolds
COG0185Ribosomal protein S19Translation, ribosomal structure and biogenesis [J] 56.60
COG0090Ribosomal protein L2Translation, ribosomal structure and biogenesis [J] 25.79
COG0089Ribosomal protein L23Translation, ribosomal structure and biogenesis [J] 5.66
COG0088Ribosomal protein L4Translation, ribosomal structure and biogenesis [J] 5.03
COG0087Ribosomal protein L3Translation, ribosomal structure and biogenesis [J] 3.77
COG0443Molecular chaperone DnaK (HSP70)Posttranslational modification, protein turnover, chaperones [O] 1.26
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 1.26
COG0093Ribosomal protein L14Translation, ribosomal structure and biogenesis [J] 0.63


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.11 %
UnclassifiedrootN/A1.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000119|KGI_S1_ANT01_95mDRAFT_c10146933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Cyanothecaceae → Cyanothece643Open in IMG/M
3300000128|SA_S1_NOR08_45mDRAFT_c10013478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3647Open in IMG/M
3300000134|BS_KBA_SWE07_21mDRAFT_c1024494All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300000401|BB_Man_B_Liq_inBBDRAFT_1040600All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300002154|JGI24538J26636_10001077All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria7353Open in IMG/M
3300003683|Ga0008459J53047_1018567All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3083Open in IMG/M
3300003860|Ga0031658_1005613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2179Open in IMG/M
3300004097|Ga0055584_100431433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1366Open in IMG/M
3300004097|Ga0055584_101395127All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300004282|Ga0066599_100026974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2049Open in IMG/M
3300006355|Ga0075501_1001825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya2918Open in IMG/M
3300006355|Ga0075501_1330032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria836Open in IMG/M
3300006357|Ga0075502_1532834All Organisms → cellular organisms → Bacteria1122Open in IMG/M
3300006378|Ga0075498_1337063All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300006383|Ga0075504_1400499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3115Open in IMG/M
3300006384|Ga0075516_1412003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3043Open in IMG/M
3300006396|Ga0075493_1012797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2953Open in IMG/M
3300006419|Ga0075496_1510349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3034Open in IMG/M
3300006850|Ga0075491_1541152All Organisms → cellular organisms → Bacteria660Open in IMG/M
3300007233|Ga0075178_1081195All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria839Open in IMG/M
3300007253|Ga0075182_10118574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria745Open in IMG/M
3300007304|Ga0102689_1751353All Organisms → cellular organisms → Eukaryota → Sar582Open in IMG/M
3300007548|Ga0102877_1073491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales979Open in IMG/M
3300007557|Ga0102821_1067479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria919Open in IMG/M
3300007561|Ga0102914_1067229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1125Open in IMG/M
3300007665|Ga0102908_1015574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1418Open in IMG/M
3300007667|Ga0102910_1011577All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1969Open in IMG/M
3300007681|Ga0102824_1001712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales7070Open in IMG/M
3300007716|Ga0102867_1017375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1836Open in IMG/M
3300007716|Ga0102867_1060993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales995Open in IMG/M
3300007972|Ga0105745_1276837All Organisms → cellular organisms → Eukaryota → Sar544Open in IMG/M
3300008117|Ga0114351_1465875All Organisms → cellular organisms → Eukaryota → Sar505Open in IMG/M
3300008119|Ga0114354_1182705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales747Open in IMG/M
3300008931|Ga0103734_1006066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1521Open in IMG/M
3300009001|Ga0102963_1431725All Organisms → cellular organisms → Eukaryota → Sar517Open in IMG/M
3300009024|Ga0102811_1022841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya2417Open in IMG/M
3300009079|Ga0102814_10006216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales7428Open in IMG/M
3300009079|Ga0102814_10312497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria855Open in IMG/M
3300009079|Ga0102814_10709022All Organisms → cellular organisms → Eukaryota → Sar553Open in IMG/M
3300009086|Ga0102812_10348551All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria805Open in IMG/M
3300009141|Ga0102884_1005596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2947Open in IMG/M
3300009142|Ga0102885_1004698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3082Open in IMG/M
3300009592|Ga0115101_1559835All Organisms → cellular organisms → Eukaryota → Sar555Open in IMG/M
3300009592|Ga0115101_1686307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3088Open in IMG/M
3300009599|Ga0115103_1355626All Organisms → cellular organisms → Eukaryota → Sar1639Open in IMG/M
3300009599|Ga0115103_1694124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3048Open in IMG/M
3300009599|Ga0115103_1853513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria788Open in IMG/M
3300009608|Ga0115100_10118417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria944Open in IMG/M
3300009735|Ga0123377_1055341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Chroococcales828Open in IMG/M
3300009738|Ga0123379_1107817All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3059Open in IMG/M
3300010129|Ga0123376_1146311All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300010309|Ga0102890_1004206All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3040Open in IMG/M
3300010997|Ga0139324_1018712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1314Open in IMG/M
3300011268|Ga0151620_1096291Not Available936Open in IMG/M
3300011968|Ga0120681_1003566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria709Open in IMG/M
3300012413|Ga0138258_1045912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria12500Open in IMG/M
3300012413|Ga0138258_1331131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3082Open in IMG/M
3300012417|Ga0138262_1179852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria6455Open in IMG/M
3300012471|Ga0129334_1047543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3255Open in IMG/M
3300012471|Ga0129334_1072880All Organisms → cellular organisms → Eukaryota → Sar581Open in IMG/M
3300012935|Ga0138257_1195223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1058Open in IMG/M
3300012954|Ga0163111_12701292All Organisms → cellular organisms → Eukaryota → Sar507Open in IMG/M
3300012962|Ga0129335_1215233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1945Open in IMG/M
3300012968|Ga0129337_1109956All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1067Open in IMG/M
3300013291|Ga0120682_1001397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria815Open in IMG/M
3300017079|Ga0186531_102829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3190Open in IMG/M
3300017773|Ga0181386_1160813All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300018049|Ga0181572_10940799All Organisms → cellular organisms → Eukaryota → Sar509Open in IMG/M
3300018605|Ga0193339_1026394All Organisms → cellular organisms → Eukaryota → Sar565Open in IMG/M
3300018684|Ga0192983_1000367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2598Open in IMG/M
3300018942|Ga0193426_10007807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1660Open in IMG/M
3300019010|Ga0193044_10004955All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2992Open in IMG/M
3300019010|Ga0193044_10005004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2984Open in IMG/M
3300019200|Ga0180036_1068035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria630Open in IMG/M
3300019200|Ga0180036_1103925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria639Open in IMG/M
3300019201|Ga0180032_1090864All Organisms → cellular organisms → Eukaryota → Sar519Open in IMG/M
3300019214|Ga0180037_1067833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1677Open in IMG/M
3300019214|Ga0180037_1090145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales2459Open in IMG/M
3300019698|Ga0193986_1017463All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300019712|Ga0193969_1029112All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales665Open in IMG/M
3300019713|Ga0193987_1024127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria683Open in IMG/M
3300019718|Ga0193999_1063717All Organisms → cellular organisms → Eukaryota → Sar502Open in IMG/M
3300019721|Ga0194011_1034006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria604Open in IMG/M
3300019726|Ga0193974_1016424All Organisms → cellular organisms → Eukaryota812Open in IMG/M
3300019742|Ga0193965_1054183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria671Open in IMG/M
3300019745|Ga0194002_1004094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1562Open in IMG/M
3300019747|Ga0193978_1053092All Organisms → cellular organisms → Eukaryota → Sar592Open in IMG/M
3300019749|Ga0193983_1008612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1093Open in IMG/M
3300019768|Ga0193960_1058150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1035Open in IMG/M
3300019937|Ga0194022_1043992All Organisms → cellular organisms → Eukaryota → Sar586Open in IMG/M
3300021087|Ga0206683_10449015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria640Open in IMG/M
3300021303|Ga0210308_1001760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3073Open in IMG/M
3300021305|Ga0210296_1115705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1285Open in IMG/M
3300021316|Ga0210351_1078293All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300021317|Ga0210309_1049071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1541Open in IMG/M
3300021323|Ga0210295_1011845All Organisms → cellular organisms → Eukaryota → Sar556Open in IMG/M
3300021348|Ga0206695_1318074All Organisms → cellular organisms → Eukaryota → Sar538Open in IMG/M
3300021353|Ga0206693_1596633All Organisms → cellular organisms → Eukaryota → Sar724Open in IMG/M
3300021379|Ga0213864_10152408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1167Open in IMG/M
3300021853|Ga0210323_1065559All Organisms → cellular organisms → Eukaryota → Sar529Open in IMG/M
3300021907|Ga0214480_110706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria513Open in IMG/M
3300022202|Ga0224498_10151947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria679Open in IMG/M
3300022353|Ga0210292_111741All Organisms → cellular organisms → Eukaryota → Sar594Open in IMG/M
3300022353|Ga0210292_113862All Organisms → cellular organisms → Eukaryota → Sar536Open in IMG/M
3300022367|Ga0210312_100192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria3089Open in IMG/M
3300022372|Ga0210293_103060Not Available1647Open in IMG/M
3300022372|Ga0210293_112590All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria844Open in IMG/M
3300022375|Ga0210313_1005831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1387Open in IMG/M
3300022375|Ga0210313_1019440All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300024348|Ga0244776_10691267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria631Open in IMG/M
3300024534|Ga0256357_1097414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria570Open in IMG/M
3300024546|Ga0256356_1029676All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1003Open in IMG/M
3300024546|Ga0256356_1035458All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales917Open in IMG/M
3300024852|Ga0255295_1092081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria582Open in IMG/M
3300024864|Ga0255271_1132121All Organisms → cellular organisms → Eukaryota → Sar545Open in IMG/M
3300025564|Ga0210084_1079692All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300025848|Ga0208005_1249940All Organisms → cellular organisms → Eukaryota → Sar547Open in IMG/M
3300025848|Ga0208005_1280333All Organisms → cellular organisms → Eukaryota → Sar512Open in IMG/M
3300025872|Ga0208783_10221044All Organisms → cellular organisms → Eukaryota → Sar776Open in IMG/M
3300025879|Ga0209555_10003835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9821Open in IMG/M
3300027159|Ga0208020_1006106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2361Open in IMG/M
3300027185|Ga0208672_1009642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya996Open in IMG/M
3300027186|Ga0208797_1050270All Organisms → cellular organisms → Eukaryota → Sar526Open in IMG/M
3300027189|Ga0208675_1008183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1331Open in IMG/M
3300027190|Ga0208674_1050780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria610Open in IMG/M
3300027191|Ga0208021_1006586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1810Open in IMG/M
3300027195|Ga0208676_1004105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1348Open in IMG/M
3300027196|Ga0208438_1000300Not Available13093Open in IMG/M
3300027218|Ga0208165_1069507All Organisms → cellular organisms → Eukaryota → Sar501Open in IMG/M
3300027229|Ga0208442_1034724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria907Open in IMG/M
3300027229|Ga0208442_1049679All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria726Open in IMG/M
3300027229|Ga0208442_1070663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya576Open in IMG/M
3300027235|Ga0208804_1004415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya1698Open in IMG/M
3300027238|Ga0208808_1030479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria675Open in IMG/M
3300027243|Ga0208174_1008522All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1282Open in IMG/M
3300027248|Ga0208176_1032448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria687Open in IMG/M
3300027248|Ga0208176_1036099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria647Open in IMG/M
3300027249|Ga0208175_1014913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria842Open in IMG/M
3300027251|Ga0208809_1070190All Organisms → cellular organisms → Eukaryota → Sar566Open in IMG/M
3300027254|Ga0208177_1001130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales3534Open in IMG/M
3300027258|Ga0208558_1010252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1348Open in IMG/M
3300027416|Ga0207994_1018377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1424Open in IMG/M
3300027418|Ga0208022_1125773All Organisms → cellular organisms → Eukaryota → Sar515Open in IMG/M
3300027525|Ga0208437_1030933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1326Open in IMG/M
3300027631|Ga0208133_1099014All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300027751|Ga0208304_10164981All Organisms → cellular organisms → Eukaryota → Sar810Open in IMG/M
3300027753|Ga0208305_10001961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria9521Open in IMG/M
3300027757|Ga0208671_10022934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria2343Open in IMG/M
3300028267|Ga0256358_1089607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria605Open in IMG/M
3300028329|Ga0210315_1007701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1243Open in IMG/M
3300028524|Ga0210314_127934All Organisms → cellular organisms → Eukaryota → Sar517Open in IMG/M
3300031569|Ga0307489_10029739All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Leptolyngbyaceae → Leptolyngbya3021Open in IMG/M
3300031589|Ga0307996_1051781All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1087Open in IMG/M
3300031786|Ga0315908_11496125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria526Open in IMG/M
3300032263|Ga0316195_10226484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales982Open in IMG/M
3300032263|Ga0316195_10587774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria595Open in IMG/M
3300033995|Ga0335003_0061964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1992Open in IMG/M
3300034105|Ga0335035_0112963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1740Open in IMG/M
3300034107|Ga0335037_0130051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales1373Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine39.62%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.06%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.92%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment5.66%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.77%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.52%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.89%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.89%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton1.26%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater Microbial Mat1.26%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment1.26%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine1.26%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.26%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.26%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.26%
Aquatic CanalEngineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal1.26%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.63%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.63%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.63%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.63%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.63%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.63%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.63%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.63%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.63%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.63%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.63%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.63%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.63%
SeawaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Seawater0.63%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.63%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.63%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.63%
Bioluminescent BayEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Bioluminescent Bay0.63%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.63%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica0.63%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000119Marine microbial communities from chronically polluted sediments in Antarctica -King George Island site S1 sample ANT 01_9.5mEnvironmentalOpen in IMG/M
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000134Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 07_21mEnvironmentalOpen in IMG/M
3300000401Marine microbial community from La Parguera, Puerto Rico - BB Mangrove B LiquidEnvironmentalOpen in IMG/M
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004282Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sedimentEnvironmentalOpen in IMG/M
3300006355Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006378Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006384Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006419Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006850Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007233Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007253Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007304Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300007548Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3EnvironmentalOpen in IMG/M
3300007557Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715EnvironmentalOpen in IMG/M
3300007561Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007667Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3EnvironmentalOpen in IMG/M
3300007681Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008119Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0110-C-NAEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009086Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713EnvironmentalOpen in IMG/M
3300009141Estuarine microbial communities from the Columbia River estuary - metaG 1550A-3EnvironmentalOpen in IMG/M
3300009142Estuarine microbial communities from the Columbia River estuary - metaG 1550B-3EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009738Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_244_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010129Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_237_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010997ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300011968Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-06EngineeredOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012471Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012962Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012968Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013291Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-07EngineeredOpen in IMG/M
3300017079Metatranscriptome of marine eukaryotic communities from Atlantic Ocean in f/2 medium, 13 C, 21 psu salinity and 150 ?mol photons light - Cyclotella meneghiniana CCMP 338 (MMETSP1057)Host-AssociatedOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019200Estuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019201Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019214Estuarine microbial communities from the Columbia River estuary - R.1189 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019698Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_2-3_MGEnvironmentalOpen in IMG/M
3300019712Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_5-6_MGEnvironmentalOpen in IMG/M
3300019713Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRC_3-4_MGEnvironmentalOpen in IMG/M
3300019718Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_5-6_MGEnvironmentalOpen in IMG/M
3300019721Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLC_7-8_MGEnvironmentalOpen in IMG/M
3300019726Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_10-11_MGEnvironmentalOpen in IMG/M
3300019742Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_8_MGEnvironmentalOpen in IMG/M
3300019745Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_8-9_MGEnvironmentalOpen in IMG/M
3300019747Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_5-6_MGEnvironmentalOpen in IMG/M
3300019749Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MGEnvironmentalOpen in IMG/M
3300019768Microbial mat bacterial communities from the Broadkill River, Lewes, Delaware, United States - FB_3_MGEnvironmentalOpen in IMG/M
3300019937Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MGEnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021316Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.485 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021317Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1088 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021323Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R9.63AS (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021853Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.189 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021907Marine eukaryotic communities from Monterey Bay, California, United States - M1_20Mar14CPVII9sort6BwellE17EnvironmentalOpen in IMG/M
3300022202Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022353Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.37A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022372Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R8.46A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022375Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1183 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024534Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024546Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024852Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024864Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025564Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025872Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027185Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689 (SPAdes)EnvironmentalOpen in IMG/M
3300027186Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 (SPAdes)EnvironmentalOpen in IMG/M
3300027189Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 (SPAdes)EnvironmentalOpen in IMG/M
3300027190Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 (SPAdes)EnvironmentalOpen in IMG/M
3300027191Estuarine microbial communities from the Columbia River estuary - metaG S.737 (SPAdes)EnvironmentalOpen in IMG/M
3300027195Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027196Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes)EnvironmentalOpen in IMG/M
3300027218Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027229Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027238Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027243Estuarine microbial communities from the Columbia River estuary - metaG 1556A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027248Estuarine microbial communities from the Columbia River estuary - metaG 1558A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027249Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027251Estuarine microbial communities from the Columbia River estuary - metaG 1556B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027254Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027258Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027416Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027525Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705 (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027751Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300028267Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028329Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Washington, United States ? R1276 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028524Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031589Marine microbial communities from David Island wharf, Antarctic Ocean - #35EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300033995Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056EnvironmentalOpen in IMG/M
3300034105Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KGI_S1_ANT01_95mDRAFT_1014693333300000119MarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFLLQAL
SA_S1_NOR08_45mDRAFT_1001347883300000128MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQA
BS_KBA_SWE07_21mDRAFT_102449413300000134MarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDD
BB_Man_B_Liq_inBBDRAFT_104060013300000401Bioluminescent BayMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQ
JGI24538J26636_1000107713300002154MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIE
Ga0008459J53047_101856763300003683SeawaterMARLELTLNFPKSFRIKTFNVKSDKKLSPLAKIILQSVQFKHFYYVRDDISYLLKSNPIE
Ga0031658_100561353300003860Freshwater Lake SedimentMARLELTLNFPKTFHIKTFNVKSEKKLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSI
Ga0055584_10043143333300004097Pelagic MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYY
Ga0055584_10139512733300004097Pelagic MarineMAGLELTLNFPESFHIKTFNLQPKKKLSPLANSILSSLKFKHFYYIRDDIAYLLKSNPVERDFLLQ
Ga0066599_10002697413300004282FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYV
Ga0075501_100182563300006355AqueousMGRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYY
Ga0075501_133003233300006355AqueousMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDD
Ga0075502_153283443300006357AqueousMACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDF
Ga0075498_133706313300006378AqueousMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHF
Ga0075504_140049913300006383AqueousMACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDD
Ga0075516_141200363300006384AqueousMARLELTLNFPKSFQVKTFNVKSKKKLSPLTKLILKSIRFKHFYY
Ga0075493_101279763300006396AqueousMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRD
Ga0075496_151034913300006419AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFL
Ga0075491_154115233300006850AqueousMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLIL
Ga0075178_108119513300007233Wastewater EffluentMARLELTLNFPKHFYIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDY
Ga0075182_1011857433300007253Wastewater EffluentMARLELTLNFPKHFYIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRD
Ga0102689_175135313300007304Freshwater LakeMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLL
Ga0102877_107349133300007548EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSAQFK
Ga0102821_106747933300007557EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIE
Ga0102914_106722913300007561EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYY
Ga0102908_101557433300007665EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSN
Ga0102910_101157713300007667EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERD
Ga0102824_100171213300007681EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSI
Ga0102867_101737513300007716EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALY
Ga0102867_106099313300007716EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALY
Ga0105745_127683723300007972Estuary WaterMARLELTLNFPKSFHIKTFNFKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVIS
Ga0114351_146587513300008117Freshwater, PlanktonMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKS
Ga0114354_118270513300008119Freshwater, PlanktonMARLELTINFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRD
Ga0103734_100606643300008931Ice Edge, Mcmurdo Sound, AntarcticaMERLELTLNFPKTFQVKTFNVKSEKKLSPLKHKVT*
Ga0102963_143172513300009001Pond WaterMPRVELTLQFPENFQVKTFNVKSEKKLSPLAKSILQSFRYKHFYYVRDDITYLLKSNPFE
Ga0102811_102284113300009024EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQ
Ga0102814_1000621613300009079EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNL
Ga0102814_1031249733300009079EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKS
Ga0102814_1070902213300009079EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSI
Ga0102812_1034855133300009086EstuarineMARLELTLNFPKSFQVKTFNVKSDKKLSPLAKLILKSLRFKHFY
Ga0102884_100559663300009141EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLIL
Ga0102885_100469813300009142EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFL
Ga0115101_155983523300009592MarineMARLELTLNFPKSFQVKTFNVKSGKKLSPLAKLILQSVQFKHFYYVRDDISYLLKS
Ga0115101_168630773300009592MarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDIS
Ga0115103_135562643300009599MarineMLKKKRTKPRVELTLKFPKKFHVKTFNVRSEKKLSPLAKLILQSVQFKHFYYARDDIFYLLNSN
Ga0115103_169412413300009599MarineMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQA
Ga0115103_185351313300009599MarineMARLELTLNFPKSFQVKTFNVKSKKKLSPLTKLILKSIRFKHFYYVRDDISYLLRSKPIERDFLLQ
Ga0115100_1011841713300009608MarineMARLELTLNFPKSFQVKTFNVKSKKKLSPLTKLILKSIRFKHFYYVRDDISYLLRSKPIERDFLL
Ga0123377_105534133300009735MarineMTCKKRKELTLKFPKYFQVKTFNVKCENSLSPLAKSILQSLQFK
Ga0123379_110781713300009738MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNP
Ga0123376_114631133300010129MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHLYYVRDISYLLKSNPIERDFL
Ga0102890_100420613300010309EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSNPSERDFL
Ga0139324_101871213300010997SedimentMARLELTLNFPKSFEIKTFNVKSEKKLCSLAQLILQSVQFKHFYSVRHDI
Ga0151620_109629113300011268FreshwaterMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYY
Ga0120681_100356633300011968Aquatic CanalMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPMERDFL
Ga0138258_104591213300012413Polar MarineMERLELTLNFPKTFQVKTFNVKSEKKLSPLAKLILKGIEFKHFYYVRDDISYLLKSNVIERDFLLQALDSIVISLQNNLC
Ga0138258_133113113300012413Polar MarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIE
Ga0138262_1179852173300012417Polar MarineLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILKSLRFKHFYYVRDDISYL*
Ga0129334_104754363300012471AqueousMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAICL
Ga0129334_107288023300012471AqueousMVRLELTLNFPKSFQIKTFNVKCEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNLNERDFLLQALY
Ga0138257_119522313300012935Polar MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSN
Ga0163111_1270129213300012954Surface SeawaterMARLELTLNFPKNFQIKTFNVKSERKLSPLAKLILQSVQFKHFYYVRDDISYLLKS
Ga0129335_121523353300012962AqueousMARLELTLNFPKRFHIKTFNVKSEKMLSPLVKSIFQSAQFKHFYYVRDDIDYLLKSQPIERDFILQALYSIV
Ga0129337_110995613300012968AqueousMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYY
Ga0120682_100139713300013291Aquatic CanalMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLK
Ga0186531_10282913300017079Host-AssociatedMACSSRGELTLKFPEYFHIKTFNIKSDKVLSPLAKSILQSLQFKHFYYVRDDLDYLLKSHPIEKDFLL
Ga0181386_116081313300017773SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKH
Ga0181572_1094079923300018049Salt MarshMICSNRGELTLKFPKYFHIKTFSVKSEKIISPLAKSILQSVQFKHFYYVRDDIYYLLK
Ga0193339_102639423300018605MarineMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKS
Ga0192983_100036763300018684MarineMKLQEIPKPRIELTLQFPKEIETEFKTFHIKSEKKLSSLAKSILQSARRKHFYYMRDDI
Ga0193426_1000780713300018942MarineMARLELTLNFPKNFKTKTFNVKSEKKLSPLAKLILQSVQFKHFYYV
Ga0193044_1000495563300019010MarineMGKRKKRKTELTLRFPKNFQRITFNIKSENKLSPLAKLILQGMQFKHFYYAR
Ga0193044_1000500463300019010MarineMGKRKTELTLRFPKNFQRVTFNIKSENKLSPLAKLILQGMQFKHFYYAR
Ga0180036_106803533300019200EstuarineMASKKRKELTLKFPECFHIKTFNVKSENMLSPFAKSTLQSLQFKHFYYVRDDLYYRLNRYPNEREFLL
Ga0180036_110392533300019200EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLL
Ga0180032_109086423300019201EstuarineMASKKRKELTLKFPECFHIKTFNVKSENMLSPFAKSTLQSLQFKHFYY
Ga0180037_106783313300019214EstuarineMARLELTLNFPKNFQTKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDI
Ga0180037_109014513300019214EstuarineMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVR
Ga0193986_101746313300019698SedimentMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKSILLSVQFKHFYYV
Ga0193969_102911233300019712SedimentMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYV
Ga0193987_102412713300019713SedimentMARLELTLNFPKSFPVKTFNVKSEKKFSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFL
Ga0193999_106371723300019718SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFY
Ga0194011_103400633300019721SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLK
Ga0193974_101642433300019726SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRD
Ga0193965_105418313300019742Freshwater Microbial MatMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQA
Ga0194002_100409443300019745SedimentMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVR
Ga0193978_105309213300019747SedimentMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYVRDDISYLLKSNPIE
Ga0193983_100861233300019749SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYS
Ga0193960_105815013300019768Freshwater Microbial MatMARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHF
Ga0194022_104399223300019937FreshwaterMASKKRKELTLKFPECFHIKTFNVKSENMLSPFAKSTLQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSIAIS
Ga0206683_1044901513300021087SeawaterMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKS
Ga0210308_100176013300021303EstuarineMARLELTLNFPKRFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIFYLLKSNPIERDFL
Ga0210296_111570533300021305EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYS
Ga0210351_107829313300021316EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQ
Ga0210309_104907143300021317EstuarineMARLELTLNFPKSFQVKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIE
Ga0210295_101184523300021323EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIE
Ga0206695_131807423300021348SeawaterMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDD
Ga0206693_159663313300021353SeawaterMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVR
Ga0213864_1015240813300021379SeawaterMARLELTLNFPKSFRIKTFNVKSDKKLSPLAKLILQSVQFKHFYYVR
Ga0210323_106555923300021853EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDI
Ga0214480_11070613300021907SeawaterKHNVKEKLNMARLELTLNFPKNFEIKTFNVKSEKKLSPLAKLILQSVRFKHFYYV
Ga0224498_1015194733300022202SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVI
Ga0210292_11174123300022353EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLL
Ga0210292_11386223300022353EstuarineMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNE
Ga0210312_10019263300022367EstuarineMVRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQ
Ga0210293_10306043300022372EstuarineMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQA
Ga0210293_11259033300022372EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLARLILQSVQFKHFYYVR
Ga0210313_100583133300022375EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLL
Ga0210313_101944013300022375EstuarineMASKKRKELTLKFPECFHIKTFNVKSENMLSPFAKSTLQILQFKHFYYVRDDLYYRLNRYPNEREFLLQALFSI
Ga0244776_1069126713300024348EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVR
Ga0256357_109741433300024534FreshwaterMARLELTLNFPERFQIKTFNVKSEQTLSPIAKSILQSVQFKHFYYVRD
Ga0256356_102967613300024546FreshwaterMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALFS
Ga0256356_103545813300024546FreshwaterMVRLELTLNFPKSFQIKTFNVKCEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNLNERDFLLQALYSIVISLQNNL
Ga0255295_109208133300024852FreshwaterMARLELTLNFPERFQIKTFNVKSEQIFSPLAKSILQSVQFKHFYYVRD
Ga0255271_113212113300024864FreshwaterMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSILQSLQFKHFYYVRDDLYYRLNRYPNEREFLLQALF
Ga0210084_107969233300025564Natural And Restored WetlandsMARLELTLNFPKSFQIKTFNVKSEKTLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPVERDFQR
Ga0208005_124994013300025848AqueousMARLELTLNFPKHFHIKTFNVKSEPMLSPLAKSILQSVQFKHFYYVRDDIDYRLRSHPMERDFLLQALF
Ga0208005_128033323300025848AqueousMSRLELTLNFPKSFQIMTFNVKSEKKLSLLAKLILQSV
Ga0208783_1022104413300025872AqueousMGRLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYFLKSNPTEKEFLLEA
Ga0209555_10003835163300025879MarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYL
Ga0208020_100610613300027159EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNV
Ga0208672_100964213300027185EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLL
Ga0208797_105027023300027186EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKS
Ga0208675_100818333300027189EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQ
Ga0208674_105078013300027190EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSN
Ga0208021_100658653300027191EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQAL
Ga0208676_100410533300027195EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLMLQNVQFKHFY
Ga0208438_100030013300027196EstuarineMARLELTLNFPKSFHIKTSNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNP
Ga0208165_106950723300027218EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSN
Ga0208442_103472433300027229EstuarineMARLELTLNFPKSFQVKTFNVKSEKTLSPLTKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQA
Ga0208442_104967913300027229EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVISLQNNLS
Ga0208442_107066333300027229EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYY
Ga0208804_100441543300027235EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISY
Ga0208808_103047913300027238EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYSIVIS
Ga0208174_100852233300027243EstuarineMARLELTLNFPKDFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIE
Ga0208176_103244833300027248EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFL
Ga0208176_103609913300027248EstuarineMARLELTLNFPKSFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPI
Ga0208175_101491313300027249EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDIS
Ga0208809_107019013300027251EstuarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDIS
Ga0208177_100113063300027254EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKQFLLCT
Ga0208558_101025233300027258EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPR
Ga0207994_101837733300027416EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQALYS
Ga0208022_112577323300027418EstuarineMGRLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYI
Ga0208437_103093333300027525EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQF
Ga0208133_109901413300027631EstuarineMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLRSN
Ga0208304_1016498113300027751EstuarineMARLELTLNFPKSFQVKTFNVKSDKKLSPLAKLILKSLRFKHFYYV
Ga0208305_10001961153300027753EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKH
Ga0208671_1002293413300027757EstuarineMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQN
Ga0256358_108960733300028267FreshwaterMASKKRKELTLKFPECFHIKTFNVKSENILSPFAKSIL
Ga0210315_100770133300028329EstuarineMARLELTLNFPERFQIKTFNVKSEQTLSPIAKSILQSVQFKHFYYVRDDIDYCLKSYPTEREFL
Ga0210314_12793423300028524EstuarineMARLELTLNFPKSFQIKTFNVKSEKNLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDFLLQ
Ga0307489_1002973963300031569Sackhole BrineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLKSNPIERDF
Ga0307996_105178113300031589MarineMARLELTLNFPKNFQIKTFNVKSEKKLSPLAKLILQSVQFKHFYYVRDD
Ga0315908_1149612513300031786FreshwaterMARLELTLNFPKSFQIKTFNVKSEKKLSPLARLILQ
Ga0316195_1022648413300032263SedimentMARLELTLNFPERFQIKTFNVKSEQIFSPLAQSILQSVQ
Ga0316195_1058777413300032263SedimentMARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYY
Ga0335003_0061964_1839_19913300033995FreshwaterMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDIS
Ga0335035_0112963_2_1813300034105FreshwaterMARLELTLNFPKSFYIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISYLLKSNPSE
Ga0335037_0130051_1217_13723300034107FreshwaterMARLELTLNFPKSFHIKTFNVKSEKKLSPLAKLILQNVQFKHFYYVRDDISY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.