NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011968

3300011968: Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-06



Overview

Basic Information
IMG/M Taxon OID3300011968 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118444 | Gp0134401 | Ga0120681
Sample NameAquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-06
Sequencing StatusPermanent Draft
Sequencing CenterWeill Cornell Medical College
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size71041634
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1
All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG22_combo_CG10-13_8_21_14_all_63_911
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameUrban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
TypeEngineered
TaxonomyEngineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationUSA:New York City
CoordinatesLat. (o)40.67Long. (o)-73.99Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037938Metagenome / Metatranscriptome167Y
F041807Metagenome / Metatranscriptome159N
F065254Metagenome128Y
F092080Metagenome107Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0120681_1003566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria709Open in IMG/M
Ga0120681_1005916All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium CG22_combo_CG10-13_8_21_14_all_63_91632Open in IMG/M
Ga0120681_1006848All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria611Open in IMG/M
Ga0120681_1016130Not Available501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0120681_1003566Ga0120681_10035663F041807MARLELTLNFPKSFQIKTFNVKSEKKLSSLAKLILQSVQFKHFYYVRDDISYLLKSNPMERDFL
Ga0120681_1005916Ga0120681_10059161F092080MCIYIPYKGGKGMQDKRVTIRIPFEIWKALRELQTVGKISSIQQAAVTGMNKLIESLKWGEEDNQRGAAKKRVLNVLVKEKPLGNWEDIHRERTESDVDRS*
Ga0120681_1006848Ga0120681_10068482F065254SNAPVALNKSSEQAEKVSVAAEALLWGCPITNFKATLPFNRMKQFFAAFKKRSHGPALARFKGYN*
Ga0120681_1016130Ga0120681_10161302F037938NKVGDRLSELAGKDLETLVNLLNVEVNKRTSSKTEFEAKKCKKSKIDDKQRGLIRRFLNVNRWITEDFYDIRDKVLAD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.