| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300013291 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118444 | Gp0134402 | Ga0120682 |
| Sample Name | Aquatic prokaryotic and eukaryotic communities from a canal in New York, USA: aquatic canal water -GCSS-07 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Weill Cornell Medical College |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 39183659 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Built Environment → Canal → Unclassified → Unclassified → Aquatic Canal → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA:New York City | |||||||
| Coordinates | Lat. (o) | 40.67 | Long. (o) | -73.99 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041807 | Metagenome / Metatranscriptome | 159 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0120682_1001397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 815 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0120682_1001397 | Ga0120682_10013971 | F041807 | MARLELTLNFPKSFEIKTFSVKSEKKLSPLAKLILQSVQFKHFYYVRDDISYLLK |
| ⦗Top⦘ |