NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F015559

Metagenome / Metatranscriptome Family F015559

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F015559
Family Type Metagenome / Metatranscriptome
Number of Sequences 253
Average Sequence Length 64 residues
Representative Sequence MSHKWGTSTKVGDAFPNVAVDIGFVGLDPNNRKMSGDLNKGQKTLWVSLPGAFTPT
Number of Associated Samples 159
Number of Associated Scaffolds 253

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 3.57 %
% of genes near scaffold ends (potentially truncated) 92.49 %
% of genes from short scaffolds (< 2000 bps) 99.60 %
Associated GOLD sequencing projects 154
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.605 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater
(41.897 % of family members)
Environment Ontology (ENVO) Unclassified
(88.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(50.593 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.52%    β-sheet: 7.14%    Coil/Unstructured: 83.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 253 Family Scaffolds
PF08534Redoxin 17.39
PF00534Glycos_transf_1 0.40
PF02932Neur_chan_memb 0.40
PF00833Ribosomal_S17e 0.40

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 253 Family Scaffolds
COG1383Ribosomal protein S17ETranslation, ribosomal structure and biogenesis [J] 0.40


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.60 %
UnclassifiedrootN/A0.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001973|GOS2217_10034018All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1909Open in IMG/M
3300003677|Ga0008458J53046_120720All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii620Open in IMG/M
3300003681|Ga0008457_1030698All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii639Open in IMG/M
3300003683|Ga0008459J53047_1011059All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii819Open in IMG/M
3300009022|Ga0103706_10102135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata663Open in IMG/M
3300009023|Ga0103928_10330345All Organisms → cellular organisms → Eukaryota577Open in IMG/M
3300009028|Ga0103708_100103907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata716Open in IMG/M
3300009543|Ga0115099_10102307All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii977Open in IMG/M
3300009592|Ga0115101_1148250All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii891Open in IMG/M
3300009592|Ga0115101_1353889All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata870Open in IMG/M
3300009592|Ga0115101_1405195All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii948Open in IMG/M
3300009592|Ga0115101_1497713All Organisms → cellular organisms → Eukaryota774Open in IMG/M
3300009592|Ga0115101_1609700All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii883Open in IMG/M
3300009599|Ga0115103_1343981All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii832Open in IMG/M
3300009606|Ga0115102_10604982All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii831Open in IMG/M
3300009608|Ga0115100_10286282All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii535Open in IMG/M
3300009608|Ga0115100_11115805All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii932Open in IMG/M
3300009677|Ga0115104_10508400All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii787Open in IMG/M
3300012408|Ga0138265_1100126All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata819Open in IMG/M
3300012408|Ga0138265_1394084All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii798Open in IMG/M
3300012412|Ga0138266_1279976All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii802Open in IMG/M
3300012413|Ga0138258_1181696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata721Open in IMG/M
3300012416|Ga0138259_1668907All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii526Open in IMG/M
3300012417|Ga0138262_1794858All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata841Open in IMG/M
3300012418|Ga0138261_1020982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata804Open in IMG/M
3300012418|Ga0138261_1421993All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii528Open in IMG/M
3300012419|Ga0138260_10270000All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii823Open in IMG/M
3300012516|Ga0129325_1299913All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata877Open in IMG/M
3300012767|Ga0138267_1042709All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii677Open in IMG/M
3300012935|Ga0138257_1809629All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii793Open in IMG/M
3300012952|Ga0163180_11440369All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii573Open in IMG/M
3300016838|Ga0186646_107353All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii936Open in IMG/M
3300016859|Ga0186645_104366All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii982Open in IMG/M
3300017014|Ga0186593_104154All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii929Open in IMG/M
3300017062|Ga0186252_108375All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii845Open in IMG/M
3300017070|Ga0186594_107777All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii881Open in IMG/M
3300017086|Ga0186647_114056All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii926Open in IMG/M
3300017258|Ga0186356_107978All Organisms → cellular organisms → Eukaryota1472Open in IMG/M
3300017315|Ga0186390_113011All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1066Open in IMG/M
3300017336|Ga0186228_116916All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii843Open in IMG/M
3300018599|Ga0188834_1012180All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii888Open in IMG/M
3300018599|Ga0188834_1012272All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii885Open in IMG/M
3300018599|Ga0188834_1013873All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii836Open in IMG/M
3300018615|Ga0192957_1033627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata820Open in IMG/M
3300018629|Ga0188875_1007467All Organisms → cellular organisms → Eukaryota778Open in IMG/M
3300018684|Ga0192983_1018434All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii915Open in IMG/M
3300018695|Ga0193259_1047325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata852Open in IMG/M
3300018710|Ga0192984_1046086All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii865Open in IMG/M
3300018710|Ga0192984_1049277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata826Open in IMG/M
3300018717|Ga0192964_1064557All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii811Open in IMG/M
3300018717|Ga0192964_1072207All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata735Open in IMG/M
3300018717|Ga0192964_1091267All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii587Open in IMG/M
3300018732|Ga0193381_1032923All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii720Open in IMG/M
3300018739|Ga0192974_1030943All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii927Open in IMG/M
3300018755|Ga0192896_1045997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata661Open in IMG/M
3300018759|Ga0192883_1060062All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii548Open in IMG/M
3300018762|Ga0192963_1040184All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii788Open in IMG/M
3300018792|Ga0192956_1077422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata876Open in IMG/M
3300018802|Ga0193388_1075986All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii524Open in IMG/M
3300018826|Ga0193394_1062685All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii610Open in IMG/M
3300018830|Ga0193191_1064885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata593Open in IMG/M
3300018831|Ga0192949_1049300All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii856Open in IMG/M
3300018846|Ga0193253_1071501All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata844Open in IMG/M
3300018848|Ga0192970_1043629All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii844Open in IMG/M
3300018853|Ga0192958_1071891All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii873Open in IMG/M
3300018864|Ga0193421_1085613All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii637Open in IMG/M
3300018867|Ga0192859_1069904All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii578Open in IMG/M
3300018871|Ga0192978_1048231All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii800Open in IMG/M
3300018874|Ga0192977_1055489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata805Open in IMG/M
3300018874|Ga0192977_1056003All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii801Open in IMG/M
3300018889|Ga0192901_1074121All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata748Open in IMG/M
3300018896|Ga0192965_1116867All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata870Open in IMG/M
3300018896|Ga0192965_1124440All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii824Open in IMG/M
3300018899|Ga0193090_1064794All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii849Open in IMG/M
3300018899|Ga0193090_1068621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata823Open in IMG/M
3300018899|Ga0193090_1073084All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii795Open in IMG/M
3300018899|Ga0193090_1075701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata780Open in IMG/M
3300018926|Ga0192989_10074714All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata868Open in IMG/M
3300018926|Ga0192989_10081541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata825Open in IMG/M
3300018948|Ga0192985_1130218All Organisms → cellular organisms → Eukaryota895Open in IMG/M
3300018948|Ga0192985_1134853All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata872Open in IMG/M
3300018948|Ga0192985_1144242All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii827Open in IMG/M
3300018979|Ga0193540_10094227All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata824Open in IMG/M
3300018980|Ga0192961_10098453All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata884Open in IMG/M
3300018982|Ga0192947_10119131All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii879Open in IMG/M
3300019000|Ga0192953_10065799All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii817Open in IMG/M
3300019025|Ga0193545_10090014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata647Open in IMG/M
3300019050|Ga0192966_10150062All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii827Open in IMG/M
3300019084|Ga0193051_107110All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii714Open in IMG/M
3300019103|Ga0192946_1035709All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii748Open in IMG/M
3300019108|Ga0192972_1039070All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii929Open in IMG/M
3300019108|Ga0192972_1052698All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata782Open in IMG/M
3300019117|Ga0193054_1044908All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii666Open in IMG/M
3300019119|Ga0192885_1021957All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata808Open in IMG/M
3300019149|Ga0188870_10073320All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii834Open in IMG/M
3300019150|Ga0194244_10026837All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii818Open in IMG/M
3300019153|Ga0192975_10140711All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii876Open in IMG/M
3300019153|Ga0192975_10160985All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata809Open in IMG/M
3300021334|Ga0206696_1082491All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii769Open in IMG/M
3300021350|Ga0206692_1729837All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii813Open in IMG/M
3300021869|Ga0063107_104492All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii839Open in IMG/M
3300021874|Ga0063147_104874All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii719Open in IMG/M
3300021875|Ga0063146_115493All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii637Open in IMG/M
3300021887|Ga0063105_1004021All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii861Open in IMG/M
3300021892|Ga0063137_1020337All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300021894|Ga0063099_1007839All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii848Open in IMG/M
3300021896|Ga0063136_1059551All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii637Open in IMG/M
3300021896|Ga0063136_1078493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300021897|Ga0063873_1018252All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii679Open in IMG/M
3300021898|Ga0063097_1006822All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii854Open in IMG/M
3300021903|Ga0063874_1082166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300021911|Ga0063106_1013260All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii848Open in IMG/M
3300021922|Ga0063869_1031992All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii659Open in IMG/M
3300021924|Ga0063085_1059828All Organisms → cellular organisms → Eukaryota575Open in IMG/M
3300021924|Ga0063085_1086558All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii562Open in IMG/M
3300021930|Ga0063145_1009393All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii676Open in IMG/M
3300021932|Ga0063872_1083855All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii542Open in IMG/M
3300021933|Ga0063756_1035808All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii701Open in IMG/M
3300021934|Ga0063139_1008592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata652Open in IMG/M
3300021935|Ga0063138_1156964All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii691Open in IMG/M
3300021936|Ga0063092_1011188All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii860Open in IMG/M
3300021940|Ga0063108_1016828All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii847Open in IMG/M
3300026465|Ga0247588_1073984All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii676Open in IMG/M
3300028671|Ga0257132_1055660All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii858Open in IMG/M
3300028672|Ga0257128_1051990All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii856Open in IMG/M
3300030670|Ga0307401_10368106All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii653Open in IMG/M
3300030671|Ga0307403_10349875All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii791Open in IMG/M
3300030871|Ga0151494_1244277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300031113|Ga0138347_10266603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata940Open in IMG/M
3300031120|Ga0073958_10006577All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii585Open in IMG/M
3300031127|Ga0073960_11330157All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1052Open in IMG/M
3300031127|Ga0073960_11481055All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii639Open in IMG/M
3300031445|Ga0073952_11878691All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii978Open in IMG/M
3300031522|Ga0307388_10478674All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii817Open in IMG/M
3300031522|Ga0307388_10482298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata814Open in IMG/M
3300031522|Ga0307388_11059319All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii550Open in IMG/M
3300031710|Ga0307386_10280327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata831Open in IMG/M
3300031729|Ga0307391_10644461All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii602Open in IMG/M
3300031729|Ga0307391_10895875All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata511Open in IMG/M
3300031734|Ga0307397_10222392All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii840Open in IMG/M
3300031735|Ga0307394_10479600All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii500Open in IMG/M
3300031737|Ga0307387_10774758All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii605Open in IMG/M
3300031738|Ga0307384_10463211All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii596Open in IMG/M
3300031739|Ga0307383_10491384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300031752|Ga0307404_10184989All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii854Open in IMG/M
3300031752|Ga0307404_10328234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata637Open in IMG/M
3300031752|Ga0307404_10351204All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii615Open in IMG/M
3300032463|Ga0314684_10273895All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii971Open in IMG/M
3300032463|Ga0314684_10279978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata961Open in IMG/M
3300032463|Ga0314684_10302060All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii928Open in IMG/M
3300032463|Ga0314684_10319268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata903Open in IMG/M
3300032463|Ga0314684_10356050All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata856Open in IMG/M
3300032463|Ga0314684_10365858All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii844Open in IMG/M
3300032463|Ga0314684_10377794All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii831Open in IMG/M
3300032470|Ga0314670_10241393All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii923Open in IMG/M
3300032470|Ga0314670_10255416All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata900Open in IMG/M
3300032470|Ga0314670_10275588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata868Open in IMG/M
3300032470|Ga0314670_10283555All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata857Open in IMG/M
3300032470|Ga0314670_10317114All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii812Open in IMG/M
3300032470|Ga0314670_10331024All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii795Open in IMG/M
3300032470|Ga0314670_10353328All Organisms → cellular organisms → Eukaryota769Open in IMG/M
3300032481|Ga0314668_10246215All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii919Open in IMG/M
3300032481|Ga0314668_10248910All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii914Open in IMG/M
3300032481|Ga0314668_10261711All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii892Open in IMG/M
3300032481|Ga0314668_10278873All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata863Open in IMG/M
3300032481|Ga0314668_10283671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata855Open in IMG/M
3300032481|Ga0314668_10456099All Organisms → cellular organisms → Eukaryota657Open in IMG/M
3300032491|Ga0314675_10241150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata896Open in IMG/M
3300032491|Ga0314675_10273526All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii841Open in IMG/M
3300032491|Ga0314675_10312247All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii785Open in IMG/M
3300032492|Ga0314679_10189931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata935Open in IMG/M
3300032492|Ga0314679_10207624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata894Open in IMG/M
3300032492|Ga0314679_10230957All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii845Open in IMG/M
3300032492|Ga0314679_10279045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata764Open in IMG/M
3300032492|Ga0314679_10356017All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii666Open in IMG/M
3300032492|Ga0314679_10387538All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata634Open in IMG/M
3300032517|Ga0314688_10266585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata903Open in IMG/M
3300032517|Ga0314688_10302552All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii852Open in IMG/M
3300032518|Ga0314689_10264547All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii899Open in IMG/M
3300032518|Ga0314689_10300184All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata843Open in IMG/M
3300032518|Ga0314689_10314257All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii823Open in IMG/M
3300032519|Ga0314676_10295665All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii948Open in IMG/M
3300032519|Ga0314676_10302594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata938Open in IMG/M
3300032519|Ga0314676_10314035All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii921Open in IMG/M
3300032519|Ga0314676_10369689All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii850Open in IMG/M
3300032519|Ga0314676_10399625All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii817Open in IMG/M
3300032519|Ga0314676_10580930All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii662Open in IMG/M
3300032520|Ga0314667_10253898All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata948Open in IMG/M
3300032520|Ga0314667_10378354All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii784Open in IMG/M
3300032521|Ga0314680_10394594All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii859Open in IMG/M
3300032521|Ga0314680_10400490All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii853Open in IMG/M
3300032521|Ga0314680_10502816All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii763Open in IMG/M
3300032521|Ga0314680_11021984All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii516Open in IMG/M
3300032540|Ga0314682_10298313All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii881Open in IMG/M
3300032540|Ga0314682_10537114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata642Open in IMG/M
3300032615|Ga0314674_10280407All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii865Open in IMG/M
3300032615|Ga0314674_10339542All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii783Open in IMG/M
3300032616|Ga0314671_10268340All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii924Open in IMG/M
3300032617|Ga0314683_10373560All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii891Open in IMG/M
3300032617|Ga0314683_10546524All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii718Open in IMG/M
3300032651|Ga0314685_10325543All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii851Open in IMG/M
3300032651|Ga0314685_10381098All Organisms → cellular organisms → Eukaryota781Open in IMG/M
3300032666|Ga0314678_10189718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata892Open in IMG/M
3300032707|Ga0314687_10284728All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii894Open in IMG/M
3300032708|Ga0314669_10298166All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii864Open in IMG/M
3300032709|Ga0314672_1297215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300032711|Ga0314681_10249363All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii965Open in IMG/M
3300032711|Ga0314681_10291981All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii898Open in IMG/M
3300032711|Ga0314681_10309467All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata874Open in IMG/M
3300032711|Ga0314681_10589425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300032713|Ga0314690_10252543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata866Open in IMG/M
3300032714|Ga0314686_10166591All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1064Open in IMG/M
3300032714|Ga0314686_10503841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata596Open in IMG/M
3300032723|Ga0314703_10098084All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii1173Open in IMG/M
3300032723|Ga0314703_10248157All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii738Open in IMG/M
3300032724|Ga0314695_1274915All Organisms → cellular organisms → Eukaryota645Open in IMG/M
3300032724|Ga0314695_1348955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata563Open in IMG/M
3300032725|Ga0314702_1163168All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii837Open in IMG/M
3300032726|Ga0314698_10189545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata928Open in IMG/M
3300032726|Ga0314698_10194553All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii916Open in IMG/M
3300032726|Ga0314698_10238679All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii827Open in IMG/M
3300032728|Ga0314696_10247846All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii907Open in IMG/M
3300032729|Ga0314697_10229638All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii823Open in IMG/M
3300032729|Ga0314697_10276774All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii748Open in IMG/M
3300032732|Ga0314711_10460588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata655Open in IMG/M
3300032733|Ga0314714_10312008All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii885Open in IMG/M
3300032733|Ga0314714_10338650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata847Open in IMG/M
3300032733|Ga0314714_10523952All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii662Open in IMG/M
3300032734|Ga0314706_10031596All Organisms → cellular organisms → Eukaryota1861Open in IMG/M
3300032734|Ga0314706_10188169All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii975Open in IMG/M
3300032742|Ga0314710_10134773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata962Open in IMG/M
3300032742|Ga0314710_10153692All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii911Open in IMG/M
3300032743|Ga0314707_10256398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata903Open in IMG/M
3300032744|Ga0314705_10036480All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → Mamiellophyceae → Mamiellales1832Open in IMG/M
3300032744|Ga0314705_10285602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata880Open in IMG/M
3300032744|Ga0314705_10395701All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata744Open in IMG/M
3300032745|Ga0314704_10260949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata950Open in IMG/M
3300032745|Ga0314704_10290177All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii902Open in IMG/M
3300032745|Ga0314704_10356419All Organisms → cellular organisms → Eukaryota810Open in IMG/M
3300032745|Ga0314704_10461520All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii702Open in IMG/M
3300032746|Ga0314701_10199536All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii894Open in IMG/M
3300032746|Ga0314701_10383674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata636Open in IMG/M
3300032746|Ga0314701_10405944All Organisms → cellular organisms → Eukaryota616Open in IMG/M
3300032747|Ga0314712_10236078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata868Open in IMG/M
3300032747|Ga0314712_10236852All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii867Open in IMG/M
3300032751|Ga0314694_10211926All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii821Open in IMG/M
3300032752|Ga0314700_10325267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata813Open in IMG/M
3300032754|Ga0314692_10291566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata882Open in IMG/M
3300032754|Ga0314692_10425835All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii717Open in IMG/M
3300032754|Ga0314692_10476780All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii671Open in IMG/M
3300032755|Ga0314709_10407283All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Prymnesiales → Chrysochromulinaceae → Chrysochromulina → Chrysochromulina tobinii838Open in IMG/M
3300032755|Ga0314709_10741418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata584Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater41.90%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine25.30%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine18.58%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine4.35%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated3.56%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.37%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.98%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.79%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.40%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.40%
Coastal WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Coastal Water0.40%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001973Marine microbial communities from Bermuda, Atlantic Ocean - GS001EnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003681Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_48_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009023Planktonic microbial communities from coastal waters of California, USA - Canon-29EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300016838Metatranscriptome of freshwater eukaryotic communities from Lake Texoma, Oklahoma in f/2 medium with seawater, f/200 nitrate, 18 C, 18 psu salinity and 617 ?mol photons light - Prymnesium parvum Texoma1 (MMETSP0814)Host-AssociatedOpen in IMG/M
3300016859Metatranscriptome of freshwater eukaryotic communities from Lake Texoma, Oklahoma in f/2 medium with seawater, f/200 phosphorous, 18 C, 18 psu salinity and 626 ?mol photons light - Prymnesium parvum Texoma1 (MMETSP0007)Host-AssociatedOpen in IMG/M
3300017014Metatranscriptome of marine eukaryotic communities from Arabian Sea in L1 medium, 20 C, 32 psu salinity and 531 ?mol photons light - unclassified eukaryote CCMP 2000 (MMETSP1178)Host-AssociatedOpen in IMG/M
3300017062Metatranscriptome of marine eukaryotic communities from Ross Sea in L1 medium with seawater, 2 C, 33 psu salinity and 569 ?mol photons light - Phaeocystis antarctica CCMP 1374 (MMETSP1444)Host-AssociatedOpen in IMG/M
3300017070Metatranscriptome of marine eukaryotic communities from Arabian Sea in L1 medium with NH4Cl, 20 C, 32 psu salinity and 478 ?mol photons light - Phaeocystis sp. CCMP2710 (MMETSP1162)Host-AssociatedOpen in IMG/M
3300017086Metatranscriptome of freshwater eukaryotic communities from Lake Texoma, Oklahoma in f/2 medium with seawater, 18 C, 18 psu salinity and 682 ?mol photons light - Prymnesium parvum Texoma1 (MMETSP0815)Host-AssociatedOpen in IMG/M
3300017258Metatranscriptome of marine eukaryotic communities from North Pacific Ocean in marine media K with soil extract, 18 C, 36 psu salinity and 435 ?mol photons light - Haptolina ericina CCMP 281 (MMETSP1096)Host-AssociatedOpen in IMG/M
3300017315Metatranscriptome of marine eukaryotic communities from Mediterranean Sea in K/2 medium, 17 C, 35 psu salinity and 672 ?mol photons light - Scyphosphaera apsteinii RCC 1455 (MMETSP1333)Host-AssociatedOpen in IMG/M
3300017336Metatranscriptome of marine eukaryotic communities from South Pacific Ocean in marine media K with soil extract, 1 C, 36 psu salinity and 391 ?mol photons light - Phaeocystis antarctica Caron Lab Isolate (MMETSP1100)Host-AssociatedOpen in IMG/M
3300018599Metatranscriptome of marine microbial communities from Baltic Sea - GS675_3p0_dTEnvironmentalOpen in IMG/M
3300018615Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782230-ERR1712123)EnvironmentalOpen in IMG/M
3300018629Metatranscriptome of marine microbial communities from Baltic Sea - GS852_ls4EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018695Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789500-ERR1719457)EnvironmentalOpen in IMG/M
3300018710Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809766-ERR1740136)EnvironmentalOpen in IMG/M
3300018717Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789634-ERR1719196)EnvironmentalOpen in IMG/M
3300018732Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001992 (ERX1789574-ERR1719298)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018755Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000720 (ERX1789582-ERR1719407)EnvironmentalOpen in IMG/M
3300018759Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000759 (ERX1789554-ERR1719287)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018792Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001398 (ERX1782120-ERR1711892)EnvironmentalOpen in IMG/M
3300018802Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789649-ERR1719297)EnvironmentalOpen in IMG/M
3300018826Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002037 (ERX1789587-ERR1719214)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018864Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789379-ERR1719364)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018889Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000728 (ERX1789501-ERR1719269)EnvironmentalOpen in IMG/M
3300018896Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001362 (ERX1789685-ERR1719483)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300019000Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001394 (ERX1782320-ERR1712129)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019119Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000701 (ERX1789718-ERR1719442)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300021334Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021874Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S32 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021897Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021903Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 20m ARK-7M ARK-7-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021922Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021924Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021932Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean - 30m ANT-15 Euk ARK-20-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021933Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Euk - ARK-7-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021934Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S18 C1 B14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021936Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-15M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021940Marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-149 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028672Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031120Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_V_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031127Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031445Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032709Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032723Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032724Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032726Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032729Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032734Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032743Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032744Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb9_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032746Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_28May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GOS2217_1003401843300001973MarineMSHKWGTSTKVGDKFPNVGVHIGFIGLDPANAKMTGDLTQGKTLWVSLPGAFTPT*
Ga0008458J53046_12072013300003677SeawaterPKPPAMAAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0008457_103069813300003681SeawaterPALFSRGGLGSIGMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT*
Ga0008459J53047_101105913300003683SeawaterRERAPKPPAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0103706_1010213523300009022Ocean WaterRRSRAMAWKLGTSTKVGDAFPDVAVDIGFAGLSMDNRKMSGALNKDKKTLWVSLPGAFTPT*
Ga0103928_1033034513300009023Coastal WaterMAWKLGTSTKVGDAFPDVAVDIGFAGLSMDNRKMSGALNKDKKTLWVSLPGAFTPT*
Ga0103708_10010390713300009028Ocean WaterHVFWERRSRAMAWKLGTSTKVGDAFPDVAVDIGFAGLSMDNRKMSGALNKDKKTLWVSLPGAFTPT*
Ga0115099_1010230723300009543MarineMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT*
Ga0115101_114825013300009592MarineHNSVRPWPYTQAAMTHKLGTSTKPGDKFPNVAVDIGFLGLDPANSKMTGDLCKEGKTLWVALPGAFTPT*
Ga0115101_135388913300009592MarineQGSTHSSDMTWKIGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT*
Ga0115101_140519513300009592MarineMSHKLGTSTKVGDAFPNVKVDIGFLGLDPANAKMTGDLTKGKKTLWVSLPGAFTPT*
Ga0115101_149771313300009592MarineRVAMSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT*
Ga0115101_160970013300009592MarineASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT*
Ga0115103_134398113300009599MarineRGRHFSLVRGLGSIGMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT*
Ga0115102_1060498223300009606MarineLFSRGGLGSIGMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT*
Ga0115100_1028628223300009608MarineRPTSTTARNSVRPWPYTQAAMTHKLGTSTKPGDKFPNVAVDIGFLGLDPANSKMTGDLCKEGKTLWVALPGAFTPT*
Ga0115100_1111580513300009608MarineRGSPPDPIVADASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT*
Ga0115104_1050840013300009677MarineMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT*
Ga0138265_110012613300012408Polar MarineDDLFVGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138265_139408423300012408Polar MarineVVGTRSREKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138266_127997613300012412Polar MarineEVVGTRSREKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138258_118169623300012413Polar MarineLFVGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIVFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138259_166890723300012416Polar MarineDEVVGTRSREKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138262_179485813300012417Polar MarinePDDLFVGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138261_102098223300012418Polar MarineTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138261_142199323300012418Polar MarineKSCVVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138260_1027000023300012419Polar MarineKSVVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0129325_129991313300012516AqueousRTTELLAAMSHKLGTSTKVGDAFPNVKVDIGFLGLDPSNAKMTGDLTKGKKTLWVSLPGAFTPT*
Ga0138267_104270913300012767Polar MarineRSREKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0138257_180962913300012935Polar MarineVVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPTNRKMSGDLNKGQKTLWVTLPGAFTPT*
Ga0163180_1144036913300012952SeawaterMAWKLGTSTKVGDAFPNVKVDIGFLGLDSNNAKMTGDLNAGKNTLWVSLPGAFTPT*
Ga0186646_10735323300016838Host-AssociatedAMSHKLGSATKVGDALPNVEVHIGFAGLSPTNAKMTGDLAKGKTLWVGLPGAFTPT
Ga0186645_10436613300016859Host-AssociatedMSHKLGSATKVGDALPNVEVHIGFAGLSPTNAKMTGDLAKGKTLWVGLPGAFTPT
Ga0186593_10415413300017014Host-AssociatedSRCPLRRFEHGARTFVMSHKWGTSTKVGDAFPNVAVDIGFAGLDPNNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0186252_10837523300017062Host-AssociatedRVVDEVVGTRSRANMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPTNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0186594_10777713300017070Host-AssociatedRRARSRRFALRRSNLGIGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMTADLNKGKILWVTLPGAFTPT
Ga0186647_11405623300017086Host-AssociatedHKLGSATKVGDALPNVEVHIGFAGLSPTNAKMTGDLAKGKTLWVGLPGAFTPT
Ga0186356_10797823300017258Host-AssociatedTISEETRVAMSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT
Ga0186390_11301113300017315Host-AssociatedKVPLFVATTISAMAYKLGTSTKAGDDFPNVFVDIGFAGLDAANRKQTGDLNQGKKTLWVSLPGAFTPT
Ga0186228_11691613300017336Host-AssociatedEERFVVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPTNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0188834_101218023300018599Freshwater LakeASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0188834_101227213300018599Freshwater LakeSAPSSEMAAHKLGTSTKVGDAFPNVAVDIGFKGLDPANGKMTGDLAKGKTLWVSLPGAFTPT
Ga0188834_101387313300018599Freshwater LakeLPRTHDTAEKGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0192957_103362723300018615MarineMAAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0188875_100746723300018629Freshwater LakeETRVAMSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTP
Ga0192983_101843413300018684MarineMGGRRTLPTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0193259_104732513300018695MarineFALRRSNLGIGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192984_104608613300018710MarineRRTLPTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192984_104927713300018710MarineDLFVGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192964_106455713300018717MarineVGTRSREKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192964_107220723300018717MarineGTTFCCTAPEPGRTMAAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192964_109126713300018717MarineKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0193381_103292323300018732MarineRRFALRRSNLGIGMAHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMTADLNKGKILWVTLPGAFTPT
Ga0192974_103094323300018739MarineRQTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192896_104599723300018755MarineRFALRRSNLGIGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192883_106006213300018759MarineLVGGLGSIGMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192963_104018423300018762MarinePTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192956_107742223300018792MarineHVGTTFCCTAPGTSRTMAAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0193388_107598613300018802MarineALRRSNLGIGMAHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMTADLNKGKILWVTLPGAFTPT
Ga0193394_106268523300018826MarineNLGIGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0193191_106488513300018830MarineERATGLHKAMAEHMGRGPAVGSTFPDVGVDIGFLGLSDDAKKSTKDLCAGKKILWVTLPGAFTPT
Ga0192949_104930023300018831MarineRTLPTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0193253_107150123300018846MarineSGGLGSIGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192970_104362923300018848MarineTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192958_107189113300018853MarineTWGTLPTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0193421_108561313300018864MarineMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192859_106990413300018867MarineFEHGARTFVMSHKWGTSTKVGDAFPNVAVDIGFAGLDPNNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192978_104823123300018871MarineKLAVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPTNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192977_105548913300018874MarineGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192977_105600313300018874MarineGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192901_107412113300018889MarineALRRSNLGSIGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192965_111686723300018896MarineTTFCCTAPEPGRTMAAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192965_112444023300018896MarineEVVGTRSREKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0193090_106479423300018899MarineSDTLPGPEAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0193090_106862113300018899MarinePDDLFVGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0193090_107308423300018899MarineRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0193090_107570113300018899MarineDAPDAPPKNAHESRMAAAHKWGSSTEAGAAFPNVAVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192989_1007471423300018926MarineRSRRFALRRSNLGIGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192989_1008154113300018926MarineALFSGGLGSIGMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192985_113021813300018948MarineDEGVAFFVGNLEGIDGSGDGKLVYALGDKRCKNFGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192985_113485323300018948MarineDGKLVYALGDKRCKNFGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192985_114424223300018948MarineAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0193540_1009422723300018979MarineHGAGADARHVFWERRSRAMAWKLGTSTKVGDAFPDVAVDIGFAGLSMDNRKMSGALNKDKKTLWVSLPGAFTPT
Ga0192961_1009845313300018980MarineTWGDDLSACCTAPGTSRTMAAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0192947_1011913123300018982MarineMAAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192953_1006579913300019000MarineMGWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0193545_1009001413300019025MarineSRRFALRRSNLGLGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192966_1015006233300019050MarineMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0193051_10711013300019084MarineLFSRGGLGSIGMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0192946_103570933300019103MarineTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192972_103907013300019108MarineQVPWCRLGRVGTPLPTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192972_105269813300019108MarineFVGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0193054_104490813300019117MarineVSPPAAPTYKLGSSVAVGSAFPSVEVDIGFVGLDPKNRKNTTDLVKGQKTLWVTLPGAFTPT
Ga0192885_102195713300019119MarineAERRSAAMAWKLGTSTTVGGAFPDVPVDIGFAGLSMDNRKSSAKLNEGKKVLWVSLPGAFTPT
Ga0188870_1007332013300019149Freshwater LakePRPALVFLVGGLGSIGMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0194244_1002683713300019150MarineHGIALTRGSIAAMSHKWGTSTKVGDKFPNVGVHIGFIGLDPANAKMTGDLTQGKTLWVSLPGAFTPT
Ga0192975_1014071123300019153MarineRTLTTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0192975_1016098513300019153MarinePLRRHHNQQPMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0206696_108249113300021334SeawaterSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0206692_172983723300021350SeawaterLGSIGMAHKWGTSTKVGDAFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0063107_10449213300021869MarineYQNPTAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063147_10487413300021874MarineSRERAPKPPAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063146_11549313300021875MarineMSHKWGTSTKVGDAFPNVAVDIGFVGLDPNNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0063105_100402113300021887MarineLLVSVHQNPTAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063137_102033713300021892MarinePESSARQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0063099_100783913300021894MarinePLVSVHQNPTAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063136_105955113300021896MarineSAFSMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMTADLNKGKILWVTLPGAFTPT
Ga0063136_107849313300021896MarineRRSAAMAWKLGTSTTVGGAFPDVPVDIGFAGLSMDNRKSSAKLNEGKKVLWVSLPGAFTP
Ga0063873_101825213300021897MarineMAAHKWGTNTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063097_100682213300021898MarineVSVHQNPTAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063874_108216613300021903MarineARQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0063106_101326013300021911MarineVHQNPTAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063869_103199213300021922MarineHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063085_105982813300021924MarineVAMSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT
Ga0063085_108655813300021924MarineMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0063145_100939313300021930MarineLSRERAPKPPAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063872_108385513300021932MarineAEKGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0063756_103580813300021933MarineFADQSTMAAHKWGTNTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063139_100859213300021934MarineRSRRFALRRSNLGIGMSHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMTGDLNKGKILWVTLPGAFTPT
Ga0063138_115696413300021935MarineRARRTMSHKMGTSTKVGDKFPDVKVDIGFLGLDPSNAKSTAELGAGKKILWVSLPGAFTP
Ga0063092_101118813300021936MarineLVSVHQNPTAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0063108_101682813300021940MarineSVHQNPTAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0247588_107398413300026465SeawaterHKWGTSTKVGDSFPNKAVDIGFVGLDPANRKMSGDLNKGKILWVTLPGAFTPT
Ga0257132_105566013300028671MarineARERAPKPPAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0257128_105199013300028672MarineRERAPKPPAMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPSNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307401_1036810613300030670MarineKSCVVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPTNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307403_1034987513300030671MarineVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0151494_124427723300030871MarineSARQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTP
Ga0138347_1026660313300031113MarineHRRGLSLSSRQDRAEMSHKLGTSTKVGDTFPDVKVDIGFLGLSPDNAKSTKELGAGKKILWVSLPGAFTPT
Ga0073958_1000657713300031120MarineTGAAEAHAWLEMSHKWGTSTKVGDAFPNVSVDIGFKGLDPANSKMSGDLIKDKKILWVTLPGAFTPT
Ga0073960_1133015723300031127MarineSTGAAEAHAWLEMSHKWGTSTKVGDAFPNVSVDIGFKGLDPANSKMSGDLIKDKKILWVTLPGAFTPT
Ga0073960_1148105513300031127MarineRMSHKLGTSTKVGDPFPNVSVDIGFKGLDPANGKMTADLCKGKKALWVALPGAFTPT
Ga0073952_1187869113300031445MarineAAEAHAWLEMSHKWGTSTKVGDAFPNVSVDIGFKGLDPANSKMSGDLIKDKKILWVTLPGAFTPT
Ga0307388_1047867423300031522MarineSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0307388_1048229813300031522MarineVGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307388_1105931913300031522MarineERVVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307386_1028032713300031710MarineTTFCCTAPGTSRTMAAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307391_1064446113300031729MarineRFVVGTRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPTNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307391_1089587523300031729MarineDDLFVGTTTSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307397_1022239223300031734MarineLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0307394_1047960013300031735MarineLPTLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0307387_1077475813300031737MarineEERVVGTRSREKMVEHKWGTSTKEGDAFPNVPVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307384_1046321113300031738MarineTRQMSEAKRQKTHKWGTSTKVGDAFPNVSVDIGFKGLDPSNAKMTGDLAFGKTLWVSLPGAFTPT
Ga0307383_1049138413300031739MarineTFCCTAPGTSRTMAAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307404_1018498913300031752MarineGHFRQPLCRSRKAMASAHKWGTSTKEGDAFPNVSVDIGFAGLDPKNRKMSGDLNKGQKTLWVSLPGAFTPT
Ga0307404_1032823423300031752MarineVGTTTSSSTMAAHKWGTSTKEGDSFPNVAVDIGFVGLDPANRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0307404_1035120413300031752MarineRSRAKMVEHKWGTSTKEGDAFPNVPVDIGFAGLDPTNRKMSGDLNKGQKTLWVTLPGAFTPT
Ga0314684_1027389523300032463SeawaterDPRQTCKLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314684_1027997823300032463SeawaterSCVRGRTTELLAAMSHKLGTSTKVGDAFPNVKVDIGFLGLDPSNAKMTGDLTKGKKTLWVSLPGAFTPT
Ga0314684_1030206023300032463SeawaterSLPRTHDTAEKGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314684_1031926813300032463SeawaterTIFCLCMGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314684_1035605033300032463SeawaterCALREHIRRSNMTHKLGTSTKVGDAFPNVGVDIGFAGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314684_1036585813300032463SeawaterSIGRRMSHKWGTTTKVGDAFPNVAVDIGFAGLSADNRKMTGDLNKGSKILWVSLPGAFTP
Ga0314684_1037779413300032463SeawaterILPKPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314670_1024139313300032470SeawaterPRQTCKLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314670_1025541623300032470SeawaterVRGRTTELLAAMSHKLGTSTKVGDAFPNVKVDIGFLGLDPSNAKMTGDLTKGKKTLWVSLPGAFTPT
Ga0314670_1027558823300032470SeawaterFCLCMGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314670_1028355513300032470SeawaterSALREHIRRSNMTHKLGTSTKVGDAFPNVGVDIGFAGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314670_1031711413300032470SeawaterEIKIVAEMSHKWGTTTKVGDAFPNVAVDIGFAGLSADNRKMTGDLNKGSKILWVSLPGAFTPT
Ga0314670_1033102413300032470SeawaterPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314670_1035332813300032470SeawaterRVAMSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT
Ga0314668_1024621513300032481SeawaterMGTSTKVGDTFPDVAVDIGFLGLSPDNAKKTKDLVAGKKTLWVSLPGAFTPT
Ga0314668_1024891013300032481SeawaterNSLPRTHDTAEKGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314668_1026171113300032481SeawaterCRADASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314668_1027887323300032481SeawaterGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314668_1028367113300032481SeawaterLREHIRRSNMTHKLGTSTKVGDAFPNVGVDIGFAGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314668_1045609913300032481SeawaterTRVAMSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT
Ga0314675_1024115013300032491SeawaterLCMGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314675_1027352613300032491SeawaterKIVAEMSHKWGTTTKVGDAFPNVAVDIGFAGLSADNRKMTGDLNKGSKILWVSLPGAFTP
Ga0314675_1031224723300032491SeawaterLPKPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314679_1018993123300032492SeawaterRHHSTMSHKLGTSTKVGDTFPDVKVDIGFLGLSPDNAKSTKELGAGKKILWVSLPGAFTP
Ga0314679_1020762413300032492SeawaterCVRGRTTELLAAMSHKLGTSTKVGDAFPNVKVDIGFLGLDPSNAKMTGDLTKGKKTLWVSLPGAFTPT
Ga0314679_1023095723300032492SeawaterADASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314679_1027904523300032492SeawaterCLCMGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314679_1035601713300032492SeawaterPKPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTP
Ga0314679_1038753823300032492SeawaterTPESSARQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0314688_1026658513300032517SeawaterIFCLCMGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314688_1030255213300032517SeawaterRTHDTAEKGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314689_1026454713300032518SeawaterWVAARSSPDLLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314689_1030018413300032518SeawaterALREHIRRSNMTHKLGTSTKVGDAFPNVGVDIGFAGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314689_1031425713300032518SeawaterTILPKPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314676_1029566523300032519SeawaterMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314676_1030259413300032519SeawaterRGRTTELLAAMSHKLGTSTKVGDAFPNVKVDIGFLGLDPSNAKMTGDLTKGKKTLWVSLPGAFTPT
Ga0314676_1031403523300032519SeawaterQTCKLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314676_1036968913300032519SeawaterDSTIILPKPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314676_1039962513300032519SeawaterVAEMSHKWGTTTKVGDAFPNVAVDIGFAGLSADNRKMTGDLNKGSKILWVSLPGAFTPT
Ga0314676_1058093013300032519SeawaterMVLGGNPEVGTVFPDVSVDIGFVGLDPANRKKTGALNAGTRNLWISLPGAFTPT
Ga0314667_1025389813300032520SeawaterGRTTELLAAMSHKLGTSTKVGDAFPNVKVDIGFLGLDPSNAKMTGDLTKGKKTLWVSLPGAFTPT
Ga0314667_1037835423300032520SeawaterKPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314680_1039459423300032521SeawaterLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314680_1040049013300032521SeawaterDTAEKGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314680_1050281623300032521SeawaterSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314680_1102198423300032521SeawaterMVLGGNPEVGTVFPDVSVDIGFVGLDPANRKKTGALNAGKRNLWISLPGAFTPT
Ga0314677_1024193113300032522SeawaterNALQFIGELLISSAAKVWKLGGPAVGTPFPNVGVDIGFLGLDPNNKKMTGDLNAGKKTLWVGLPGAFTPT
Ga0314682_1029831323300032540SeawaterLATCKLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314682_1053711423300032540SeawaterCGTPESSARQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0314674_1028040723300032615SeawaterDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314674_1033954223300032615SeawaterAEMSHKWGTTTKVGDAFPNVAVDIGFAGLSADNRKMTGDLNKGSKILWVSLPGAFTPT
Ga0314671_1026834013300032616SeawaterPDPRQTCKLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314683_1037356023300032617SeawaterLHRNLLPMTHKLGTTTKVGDAFPDVKVDIGFLGLDPKNAKQTSELNKGKNVLWVSLPGAFTPT
Ga0314683_1054652413300032617SeawaterKLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314685_1032554313300032651SeawaterMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314685_1038109813300032651SeawaterMSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT
Ga0314678_1018971813300032666SeawaterCMGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314687_1028472813300032707SeawaterARSCRADASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314669_1029816613300032708SeawaterHDTAEKGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314672_129721513300032709SeawaterRLCGTPESSARQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0314681_1024936313300032711SeawaterRQTCKLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314681_1029198113300032711SeawaterTHDTAEKGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314681_1030946713300032711SeawaterREHIRRSNMTHKLGTSTKVGDAFPNVGVDIGFAGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314681_1058942523300032711SeawaterTELLAAMSHKLGTSTKVGDAFPNVKVDIGFLGLDPSNAKMTGDLTKGKKTLWVSLPGAFTPT
Ga0314690_1025254323300032713SeawaterCKLDAEPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314686_1016659123300032714SeawaterAKLELKSLHRNLLPMTHKLGTTTKVGDAFPDVKVDLGFLGLDPKNAKQTSELNKGKNVLWVSLPGAFTPT
Ga0314686_1050384113300032714SeawaterMSHKLGTSTKVGDTFPDVKVDIGFLGLSPDNAKSTKELGAGKKILWVSLPGAFTPT
Ga0314703_1009808423300032723SeawaterSTRLFVRACGCQGGKTMAHKLGTNTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314703_1024815723300032723SeawaterRADASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314695_127491523300032724SeawaterSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT
Ga0314695_134895523300032724SeawaterPESSATNMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0314702_116316813300032725SeawaterADLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314698_1018954513300032726SeawaterESSARQTMSWKLGTNTKVGDAFPDAQVDIGFEGLDQANRKSNKELNAGKKNLWVSLPGAFTPT
Ga0314698_1019455313300032726SeawaterSCRADASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314698_1023867913300032726SeawaterIKIVAEMSHKWGTTTKVGDAFPNVAVDIGFAGLSADNRKMTGDLNKGSKILWVSLPGAFTPT
Ga0314696_1024784623300032728SeawaterPRDMSHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314697_1022963813300032729SeawaterEIKIDAEMSHKWGTTTKVGDAFPNVAVDIGFAGLSADNRKMTGDLNKGSKILWVSLPGAFTPT
Ga0314697_1027677423300032729SeawaterWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314711_1046058823300032732SeawaterGTPESSARQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0314714_1031200813300032733SeawaterTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314714_1033865023300032733SeawaterMLVTIFCLCMGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314714_1052395213300032733SeawaterHKLGTSTKVGDTFPDVKVDIGFLGLSPDNAKSTKELGAGKKILWVSLPGAFTPT
Ga0314706_1003159613300032734SeawaterKPISTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314706_1018816923300032734SeawaterMSHKWGTTTKVGDAFPNVAVDIGFAGLSADNRKMTGDLNKGSKILWVSLPGAFTPT
Ga0314710_1013477313300032742SeawaterRTTELLAAMSHKLGTSTKVGDAFPNVKVDIGFLGLDPSNAKMTGDLTKGKKTLWVSLPGAFTPT
Ga0314710_1015369213300032742SeawaterMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314707_1025639813300032743SeawaterSTVALREHIRRSNMTHKLGTSTKVGDAFPNVGVDIGFAGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314705_1003648023300032744SeawaterMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314705_1028560213300032744SeawaterALAPPPPPGALREHIRRSNMTHKLGTSTKVGDAFPNVGVDIGFAGLDPANKKMTGDLAKGNTLWVSLPGAFTPT
Ga0314705_1039570113300032744SeawaterQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0314704_1026094913300032745SeawaterHHSTMSHKLGTSTKVGDTFPDVKVDIGFLGLSPDNAKSTKELGAGKKILWVSLPGAFTPT
Ga0314704_1029017713300032745SeawaterDASRTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314704_1035641923300032745SeawaterEETRVAMSHKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT
Ga0314704_1046152013300032745SeawaterHKLGTTTKVGDAFPDVKVDIGFLGLDPKNAKQTSELNKGKNVLWVSLPGAFTPT
Ga0314701_1019953613300032746SeawaterPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314701_1038367413300032746SeawaterRIVGATNMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0314701_1040594423300032746SeawaterKWGTSTKVGDTFPDVEVDIGFLGLSPDNQKKTGALNAGKKVLWVSLPGAFTPT
Ga0314712_1023607813300032747SeawaterMGSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314712_1023685223300032747SeawaterGTSTKVGDTFPDVAVDIGFLGLSPDNAKKTKDLVAGKKTLWVSLPGAFTPT
Ga0314694_1021192613300032751SeawaterIILPKPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314700_1032526723300032752SeawaterSTHSSDMTWKLGTSTKVGDPFPDVPVDIGFKGLDPKNAKSTAELNKGKKNLWVTLPGAFTPT
Ga0314692_1029156613300032754SeawaterMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT
Ga0314692_1042583523300032754SeawaterRDSRRPHRWISGSAMTHKLGTSTKVGDAFPNVAVDIGFLGLDPANKKMTGDLAKGKTLWVSLPGAFTPT
Ga0314692_1047678013300032754SeawaterPDSTTILPKPLSTMTWKLGTSTKVGDTFPDVKVDIGFLGLDPANAKMTGTLAKGKTLWVSLPGAFTPT
Ga0314709_1040728323300032755SeawaterRADASWTPTTMAHKMGTSTKVGDTFPDVSVDIGFLGLSPDNAKKTSDLVKGKKTLWVSLPGAFTPT
Ga0314709_1074141823300032755SeawaterSTVHGSSARQTMSWKLGTNTKVGDAFPDAQVDIGFVGLDPANRKSTKELNAGKKNLWVSLPGAFTPT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.