| Basic Information | |
|---|---|
| Family ID | F014281 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 264 |
| Average Sequence Length | 42 residues |
| Representative Sequence | CNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Number of Associated Samples | 232 |
| Number of Associated Scaffolds | 264 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 28.79 % |
| % of genes near scaffold ends (potentially truncated) | 54.92 % |
| % of genes from short scaffolds (< 2000 bps) | 87.50 % |
| Associated GOLD sequencing projects | 218 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.561 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.848 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.758 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.455 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.24% β-sheet: 0.00% Coil/Unstructured: 61.76% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 264 Family Scaffolds |
|---|---|---|
| PF05175 | MTS | 18.94 |
| PF01343 | Peptidase_S49 | 12.12 |
| PF13659 | Obsolete Pfam Family | 6.44 |
| PF01972 | SDH_sah | 5.68 |
| PF09413 | DUF2007 | 4.92 |
| PF00348 | polyprenyl_synt | 2.27 |
| PF02091 | tRNA-synt_2e | 1.14 |
| PF13450 | NAD_binding_8 | 0.76 |
| PF01810 | LysE | 0.38 |
| PF04480 | DUF559 | 0.38 |
| PF08544 | GHMP_kinases_C | 0.38 |
| PF07587 | PSD1 | 0.38 |
| PF07748 | Glyco_hydro_38C | 0.38 |
| PF00574 | CLP_protease | 0.38 |
| PF03167 | UDG | 0.38 |
| PF00300 | His_Phos_1 | 0.38 |
| COG ID | Name | Functional Category | % Frequency in 264 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 36.36 |
| COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 2.27 |
| COG0752 | Glycyl-tRNA synthetase, alpha subunit | Translation, ribosomal structure and biogenesis [J] | 1.14 |
| COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 0.76 |
| COG0383 | Alpha-mannosidase | Carbohydrate transport and metabolism [G] | 0.38 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.38 |
| COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.38 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.38 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.56 % |
| Unclassified | root | N/A | 6.44 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2032320005|FACEOR_FY84VJD01C9VW1 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 503 | Open in IMG/M |
| 3300000956|JGI10216J12902_100886935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1953 | Open in IMG/M |
| 3300001137|JGI12637J13337_1027602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 515 | Open in IMG/M |
| 3300001661|JGI12053J15887_10538310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 557 | Open in IMG/M |
| 3300002886|JGI25612J43240_1006619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1633 | Open in IMG/M |
| 3300002910|JGI25615J43890_1072939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 593 | Open in IMG/M |
| 3300002914|JGI25617J43924_10069495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ai1a-2 | 1287 | Open in IMG/M |
| 3300002917|JGI25616J43925_10023358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2743 | Open in IMG/M |
| 3300003203|JGI25406J46586_10001380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 11459 | Open in IMG/M |
| 3300003203|JGI25406J46586_10130655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 736 | Open in IMG/M |
| 3300003659|JGI25404J52841_10009582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2072 | Open in IMG/M |
| 3300004080|Ga0062385_11094871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 540 | Open in IMG/M |
| 3300004081|Ga0063454_100741448 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 748 | Open in IMG/M |
| 3300004114|Ga0062593_101019078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 851 | Open in IMG/M |
| 3300004114|Ga0062593_102580197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 577 | Open in IMG/M |
| 3300004114|Ga0062593_102695546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 566 | Open in IMG/M |
| 3300004153|Ga0063455_100656038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 696 | Open in IMG/M |
| 3300004479|Ga0062595_100492715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 917 | Open in IMG/M |
| 3300004479|Ga0062595_100797277 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 777 | Open in IMG/M |
| 3300005163|Ga0066823_10070642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 669 | Open in IMG/M |
| 3300005172|Ga0066683_10074859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2031 | Open in IMG/M |
| 3300005178|Ga0066688_10014408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 4014 | Open in IMG/M |
| 3300005179|Ga0066684_10631697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 720 | Open in IMG/M |
| 3300005328|Ga0070676_10396004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 960 | Open in IMG/M |
| 3300005332|Ga0066388_101137612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1326 | Open in IMG/M |
| 3300005332|Ga0066388_101619505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1140 | Open in IMG/M |
| 3300005332|Ga0066388_104254857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 730 | Open in IMG/M |
| 3300005332|Ga0066388_107945637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 531 | Open in IMG/M |
| 3300005336|Ga0070680_101719163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 544 | Open in IMG/M |
| 3300005355|Ga0070671_102025283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 512 | Open in IMG/M |
| 3300005356|Ga0070674_100833498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 799 | Open in IMG/M |
| 3300005434|Ga0070709_10650573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 816 | Open in IMG/M |
| 3300005440|Ga0070705_100525392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 903 | Open in IMG/M |
| 3300005450|Ga0066682_10218369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1224 | Open in IMG/M |
| 3300005456|Ga0070678_101234929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 694 | Open in IMG/M |
| 3300005459|Ga0068867_101725159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 587 | Open in IMG/M |
| 3300005511|Ga0077121_10722829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 624 | Open in IMG/M |
| 3300005563|Ga0068855_101047643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 855 | Open in IMG/M |
| 3300005563|Ga0068855_101113868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 825 | Open in IMG/M |
| 3300005578|Ga0068854_100244618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1430 | Open in IMG/M |
| 3300005616|Ga0068852_100008001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 7753 | Open in IMG/M |
| 3300005616|Ga0068852_102561194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 530 | Open in IMG/M |
| 3300005713|Ga0066905_102271234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 507 | Open in IMG/M |
| 3300005764|Ga0066903_100932036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1577 | Open in IMG/M |
| 3300005764|Ga0066903_102013303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1110 | Open in IMG/M |
| 3300005840|Ga0068870_11345735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 521 | Open in IMG/M |
| 3300005841|Ga0068863_101846422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 614 | Open in IMG/M |
| 3300005843|Ga0068860_102747092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 511 | Open in IMG/M |
| 3300005937|Ga0081455_10026074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 5385 | Open in IMG/M |
| 3300005983|Ga0081540_1017427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4449 | Open in IMG/M |
| 3300005983|Ga0081540_1118898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1101 | Open in IMG/M |
| 3300005993|Ga0080027_10256918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 690 | Open in IMG/M |
| 3300006046|Ga0066652_100171376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1841 | Open in IMG/M |
| 3300006048|Ga0075363_100774063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 582 | Open in IMG/M |
| 3300006050|Ga0075028_100074447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1685 | Open in IMG/M |
| 3300006050|Ga0075028_100091272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1538 | Open in IMG/M |
| 3300006059|Ga0075017_100902769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 686 | Open in IMG/M |
| 3300006086|Ga0075019_10966339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 549 | Open in IMG/M |
| 3300006176|Ga0070765_100820408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 879 | Open in IMG/M |
| 3300006354|Ga0075021_10445258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 816 | Open in IMG/M |
| 3300006573|Ga0074055_11059839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 634 | Open in IMG/M |
| 3300006804|Ga0079221_11043266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 619 | Open in IMG/M |
| 3300006804|Ga0079221_11576409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 530 | Open in IMG/M |
| 3300006806|Ga0079220_10532988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 813 | Open in IMG/M |
| 3300006852|Ga0075433_11226479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 651 | Open in IMG/M |
| 3300006852|Ga0075433_11280919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 635 | Open in IMG/M |
| 3300006854|Ga0075425_100007379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 11620 | Open in IMG/M |
| 3300006871|Ga0075434_100554763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1168 | Open in IMG/M |
| 3300006872|Ga0101947_1028920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1453 | Open in IMG/M |
| 3300006881|Ga0068865_100376774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1156 | Open in IMG/M |
| 3300006904|Ga0075424_101152181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 826 | Open in IMG/M |
| 3300006914|Ga0075436_100530867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 863 | Open in IMG/M |
| 3300009012|Ga0066710_100939027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1333 | Open in IMG/M |
| 3300009012|Ga0066710_103141955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 637 | Open in IMG/M |
| 3300009038|Ga0099829_10507864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1001 | Open in IMG/M |
| 3300009088|Ga0099830_11224551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 623 | Open in IMG/M |
| 3300009088|Ga0099830_11687401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 528 | Open in IMG/M |
| 3300009089|Ga0099828_10223751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1683 | Open in IMG/M |
| 3300009101|Ga0105247_11099439 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHA0002 | 627 | Open in IMG/M |
| 3300009137|Ga0066709_102352379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 727 | Open in IMG/M |
| 3300009143|Ga0099792_10931360 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 577 | Open in IMG/M |
| 3300009148|Ga0105243_10991704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 842 | Open in IMG/M |
| 3300009177|Ga0105248_10679733 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1161 | Open in IMG/M |
| 3300009347|Ga0115920_1192406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 553 | Open in IMG/M |
| 3300009661|Ga0105858_1214688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 571 | Open in IMG/M |
| 3300009792|Ga0126374_10276774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1111 | Open in IMG/M |
| 3300010043|Ga0126380_10815947 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 765 | Open in IMG/M |
| 3300010043|Ga0126380_11188132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 656 | Open in IMG/M |
| 3300010043|Ga0126380_11645105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 575 | Open in IMG/M |
| 3300010047|Ga0126382_11897340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 563 | Open in IMG/M |
| 3300010050|Ga0133945_117856 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 621 | Open in IMG/M |
| 3300010207|Ga0136445_100178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 33112 | Open in IMG/M |
| 3300010321|Ga0134067_10368531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 569 | Open in IMG/M |
| 3300010359|Ga0126376_12365501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 578 | Open in IMG/M |
| 3300010366|Ga0126379_12474122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 618 | Open in IMG/M |
| 3300010371|Ga0134125_10183036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 2333 | Open in IMG/M |
| 3300010397|Ga0134124_11105008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 809 | Open in IMG/M |
| 3300010401|Ga0134121_10254943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1537 | Open in IMG/M |
| 3300010401|Ga0134121_10380252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1270 | Open in IMG/M |
| 3300010403|Ga0134123_12073245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 628 | Open in IMG/M |
| 3300010877|Ga0126356_11089549 | Not Available | 1840 | Open in IMG/M |
| 3300011119|Ga0105246_10166052 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1686 | Open in IMG/M |
| 3300011269|Ga0137392_10249292 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1461 | Open in IMG/M |
| 3300011269|Ga0137392_10591419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 921 | Open in IMG/M |
| 3300012189|Ga0137388_10347738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1367 | Open in IMG/M |
| 3300012212|Ga0150985_105801869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 559 | Open in IMG/M |
| 3300012212|Ga0150985_114987743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
| 3300012356|Ga0137371_10296193 | Not Available | 1261 | Open in IMG/M |
| 3300012469|Ga0150984_112649639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 557 | Open in IMG/M |
| 3300012582|Ga0137358_10537132 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 787 | Open in IMG/M |
| 3300012685|Ga0137397_10857465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 674 | Open in IMG/M |
| 3300012893|Ga0157284_10322561 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012905|Ga0157296_10306059 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 558 | Open in IMG/M |
| 3300012906|Ga0157295_10301740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 560 | Open in IMG/M |
| 3300012918|Ga0137396_10584632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 826 | Open in IMG/M |
| 3300012922|Ga0137394_11562185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 517 | Open in IMG/M |
| 3300012924|Ga0137413_11600276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 532 | Open in IMG/M |
| 3300012929|Ga0137404_12024969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 537 | Open in IMG/M |
| 3300012943|Ga0164241_10557966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 827 | Open in IMG/M |
| 3300012948|Ga0126375_10356683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1040 | Open in IMG/M |
| 3300012951|Ga0164300_10008676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 3096 | Open in IMG/M |
| 3300012955|Ga0164298_10421674 | Not Available | 869 | Open in IMG/M |
| 3300012971|Ga0126369_10313584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1575 | Open in IMG/M |
| 3300012985|Ga0164308_11616320 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 599 | Open in IMG/M |
| 3300012986|Ga0164304_11438343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 568 | Open in IMG/M |
| 3300013100|Ga0157373_11295217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
| 3300013105|Ga0157369_11408051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 710 | Open in IMG/M |
| 3300014160|Ga0181517_10036975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3116 | Open in IMG/M |
| 3300014164|Ga0181532_10042549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 3051 | Open in IMG/M |
| 3300014167|Ga0181528_10050508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2306 | Open in IMG/M |
| 3300014201|Ga0181537_10490467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 841 | Open in IMG/M |
| 3300014326|Ga0157380_12539526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 578 | Open in IMG/M |
| 3300014491|Ga0182014_10022022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 5328 | Open in IMG/M |
| 3300014493|Ga0182016_10256556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1092 | Open in IMG/M |
| 3300014497|Ga0182008_10104810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1399 | Open in IMG/M |
| 3300014501|Ga0182024_10767093 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1180 | Open in IMG/M |
| 3300015075|Ga0167636_1029673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 694 | Open in IMG/M |
| 3300015087|Ga0167637_1004666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2062 | Open in IMG/M |
| 3300015371|Ga0132258_12896225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1193 | Open in IMG/M |
| 3300015372|Ga0132256_100093348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2914 | Open in IMG/M |
| 3300015372|Ga0132256_100257315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1817 | Open in IMG/M |
| 3300015372|Ga0132256_100342694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1587 | Open in IMG/M |
| 3300016270|Ga0182036_10717825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 810 | Open in IMG/M |
| 3300016404|Ga0182037_10899786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 767 | Open in IMG/M |
| 3300018035|Ga0187875_10502075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 643 | Open in IMG/M |
| 3300018053|Ga0184626_10017205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2905 | Open in IMG/M |
| 3300018061|Ga0184619_10186017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 953 | Open in IMG/M |
| 3300018061|Ga0184619_10532775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 515 | Open in IMG/M |
| 3300018076|Ga0184609_10139139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1112 | Open in IMG/M |
| 3300018085|Ga0187772_11085848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 587 | Open in IMG/M |
| 3300018466|Ga0190268_12065616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 527 | Open in IMG/M |
| 3300019377|Ga0190264_10843071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 705 | Open in IMG/M |
| 3300019890|Ga0193728_1137103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1091 | Open in IMG/M |
| 3300020002|Ga0193730_1074479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 964 | Open in IMG/M |
| 3300020004|Ga0193755_1138005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 749 | Open in IMG/M |
| 3300020034|Ga0193753_10221665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 856 | Open in IMG/M |
| 3300020061|Ga0193716_1091230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1326 | Open in IMG/M |
| 3300020140|Ga0179590_1010502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1983 | Open in IMG/M |
| 3300020579|Ga0210407_11022200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 629 | Open in IMG/M |
| 3300020580|Ga0210403_10483300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1007 | Open in IMG/M |
| 3300020583|Ga0210401_10697438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 876 | Open in IMG/M |
| 3300021168|Ga0210406_10497353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 965 | Open in IMG/M |
| 3300021178|Ga0210408_10177736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1690 | Open in IMG/M |
| 3300021178|Ga0210408_11426210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 521 | Open in IMG/M |
| 3300021402|Ga0210385_10979228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 650 | Open in IMG/M |
| 3300021403|Ga0210397_10058941 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2484 | Open in IMG/M |
| 3300021403|Ga0210397_10263226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1256 | Open in IMG/M |
| 3300021405|Ga0210387_10934283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 762 | Open in IMG/M |
| 3300021407|Ga0210383_11273295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 616 | Open in IMG/M |
| 3300021858|Ga0213852_1412772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 519 | Open in IMG/M |
| 3300022724|Ga0242665_10041115 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1190 | Open in IMG/M |
| 3300022756|Ga0222622_10307099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1093 | Open in IMG/M |
| 3300022756|Ga0222622_10981258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 620 | Open in IMG/M |
| 3300022891|Ga0247770_1125794 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 771 | Open in IMG/M |
| 3300023046|Ga0233356_1046878 | Not Available | 538 | Open in IMG/M |
| 3300025900|Ga0207710_10520837 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 618 | Open in IMG/M |
| 3300025909|Ga0207705_10677189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 802 | Open in IMG/M |
| 3300025912|Ga0207707_10178237 | All Organisms → cellular organisms → Bacteria | 1856 | Open in IMG/M |
| 3300025917|Ga0207660_10502850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 983 | Open in IMG/M |
| 3300025917|Ga0207660_10595194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia broomeae | 901 | Open in IMG/M |
| 3300025920|Ga0207649_11002664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 657 | Open in IMG/M |
| 3300025924|Ga0207694_11176995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 649 | Open in IMG/M |
| 3300025928|Ga0207700_11561727 | Not Available | 585 | Open in IMG/M |
| 3300025931|Ga0207644_10509484 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 993 | Open in IMG/M |
| 3300025937|Ga0207669_10465338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 1005 | Open in IMG/M |
| 3300025938|Ga0207704_10620506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
| 3300025949|Ga0207667_10702634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1013 | Open in IMG/M |
| 3300025981|Ga0207640_11118426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 698 | Open in IMG/M |
| 3300026023|Ga0207677_10458759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1093 | Open in IMG/M |
| 3300026041|Ga0207639_11396802 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
| 3300026121|Ga0207683_10424209 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1225 | Open in IMG/M |
| 3300026215|Ga0209849_1068243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 626 | Open in IMG/M |
| 3300026304|Ga0209240_1013495 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3112 | Open in IMG/M |
| 3300026319|Ga0209647_1041771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2558 | Open in IMG/M |
| 3300026331|Ga0209267_1158033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 927 | Open in IMG/M |
| 3300026333|Ga0209158_1313571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 541 | Open in IMG/M |
| 3300026351|Ga0257170_1027492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 761 | Open in IMG/M |
| 3300026469|Ga0257169_1049488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 659 | Open in IMG/M |
| 3300026469|Ga0257169_1077210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 542 | Open in IMG/M |
| 3300026528|Ga0209378_1151071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 926 | Open in IMG/M |
| 3300026557|Ga0179587_10768535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 635 | Open in IMG/M |
| 3300027011|Ga0207740_1034131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 612 | Open in IMG/M |
| 3300027266|Ga0209215_1029959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 724 | Open in IMG/M |
| 3300027383|Ga0209213_1011233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1625 | Open in IMG/M |
| 3300027528|Ga0208985_1046025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 849 | Open in IMG/M |
| 3300027559|Ga0209222_1115492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 518 | Open in IMG/M |
| 3300027610|Ga0209528_1026005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1292 | Open in IMG/M |
| 3300027655|Ga0209388_1158735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 637 | Open in IMG/M |
| 3300027669|Ga0208981_1128078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 647 | Open in IMG/M |
| 3300027718|Ga0209795_10179979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 594 | Open in IMG/M |
| 3300027853|Ga0209274_10707976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 519 | Open in IMG/M |
| 3300027959|Ga0209477_1178314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 689 | Open in IMG/M |
| 3300028565|Ga0302145_10027268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2074 | Open in IMG/M |
| 3300028792|Ga0307504_10045020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1237 | Open in IMG/M |
| 3300028802|Ga0307503_10036276 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1778 | Open in IMG/M |
| 3300028814|Ga0307302_10317478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 767 | Open in IMG/M |
| 3300028819|Ga0307296_10689984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 558 | Open in IMG/M |
| 3300028867|Ga0302146_10149503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 941 | Open in IMG/M |
| 3300029954|Ga0311331_11099625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 680 | Open in IMG/M |
| 3300029989|Ga0311365_11324364 | Not Available | 619 | Open in IMG/M |
| 3300029990|Ga0311336_10163110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1801 | Open in IMG/M |
| 3300029990|Ga0311336_12024742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 511 | Open in IMG/M |
| 3300030058|Ga0302179_10196952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 890 | Open in IMG/M |
| 3300030503|Ga0311370_10289645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2127 | Open in IMG/M |
| 3300030904|Ga0308198_1077918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 553 | Open in IMG/M |
| 3300030943|Ga0311366_11445618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium valentinum | 590 | Open in IMG/M |
| 3300031093|Ga0308197_10138952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 767 | Open in IMG/M |
| 3300031152|Ga0307501_10116603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 692 | Open in IMG/M |
| 3300031170|Ga0307498_10012229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1756 | Open in IMG/M |
| 3300031231|Ga0170824_101543665 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 533 | Open in IMG/M |
| 3300031231|Ga0170824_115431564 | Not Available | 626 | Open in IMG/M |
| 3300031232|Ga0302323_102194209 | Not Available | 629 | Open in IMG/M |
| 3300031236|Ga0302324_100723449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1400 | Open in IMG/M |
| 3300031239|Ga0265328_10302461 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 618 | Open in IMG/M |
| 3300031366|Ga0307506_10047552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 1234 | Open in IMG/M |
| 3300031474|Ga0170818_100553542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 502 | Open in IMG/M |
| 3300031524|Ga0302320_10341675 | Not Available | 1942 | Open in IMG/M |
| 3300031712|Ga0265342_10174492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1180 | Open in IMG/M |
| 3300031720|Ga0307469_10782294 | Not Available | 874 | Open in IMG/M |
| 3300031722|Ga0311351_10869183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 689 | Open in IMG/M |
| 3300031730|Ga0307516_10649396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 710 | Open in IMG/M |
| 3300031740|Ga0307468_100129926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1572 | Open in IMG/M |
| 3300031823|Ga0307478_10428718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1098 | Open in IMG/M |
| 3300031879|Ga0306919_11274482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 557 | Open in IMG/M |
| 3300031890|Ga0306925_10310582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1695 | Open in IMG/M |
| 3300031902|Ga0302322_102177893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 682 | Open in IMG/M |
| 3300031912|Ga0306921_11078611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 901 | Open in IMG/M |
| 3300031939|Ga0308174_10090333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2175 | Open in IMG/M |
| 3300031954|Ga0306926_12332202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 592 | Open in IMG/M |
| 3300032174|Ga0307470_11114746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 635 | Open in IMG/M |
| 3300032205|Ga0307472_100693300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 915 | Open in IMG/M |
| 3300032261|Ga0306920_101734831 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 883 | Open in IMG/M |
| 3300033289|Ga0310914_10652694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 946 | Open in IMG/M |
| 3300033405|Ga0326727_10080387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4552 | Open in IMG/M |
| 3300033475|Ga0310811_11070403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 690 | Open in IMG/M |
| 3300034127|Ga0370489_0104929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 825 | Open in IMG/M |
| 3300034358|Ga0370485_0157487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 691 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.82% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.41% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.41% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.65% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.27% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.27% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.89% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.89% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.89% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.89% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.89% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.52% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.52% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.14% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.14% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.14% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.14% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.76% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.76% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.76% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.76% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.38% |
| Littoral | Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral | 0.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.38% |
| Xenic Strain | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Xenic Strain | 0.38% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.38% |
| Glacier Forefield Soils | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soils | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.38% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.38% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.38% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.38% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.38% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.38% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.38% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.38% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.38% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.38% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.38% |
| Swimming Pool Sandfilter Backwash | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Swimming Pool Sandfilter Backwash | 0.38% |
| Drinking Water Pipes | Engineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes | 0.38% |
| Wastewater Bioreactor | Engineered → Bioremediation → Hydrocarbon → Unclassified → Unclassified → Wastewater Bioreactor | 0.38% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.38% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2032320005 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006872 | Biofilm microbial communities from drinking water pipes in Singapore | Engineered | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009070 | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocy_expt_1000_biof (version 2) | Engineered | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009347 | Microbial communities from sand-filter backwash in Singapore swimming pools - JW-1 | Engineered | Open in IMG/M |
| 3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010050 | Microbial community associated with xenic strain of Nostoc sp. EX-5-1 | Environmental | Open in IMG/M |
| 3300010207 | Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FC X16C | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015075 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G5C, Northern proglacial tributary margin, adjacent to top of river) | Environmental | Open in IMG/M |
| 3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022891 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L136-409B-6 | Environmental | Open in IMG/M |
| 3300023046 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026215 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026351 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027718 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027959 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB14_supernatant (SPAdes) | Engineered | Open in IMG/M |
| 3300028565 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028867 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
| 3300034358 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FACEORA_1999670 | 2032320005 | Soil | VKAAGAAEKDMKVYLLMVLIGTLLTAIRFTSMPKQPSKTLP |
| JGI10216J12902_1008869352 | 3300000956 | Soil | MPFALLRDGCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEQPSETLPQ* |
| JGI12637J13337_10276021 | 3300001137 | Forest Soil | VAANDAAENDMKVYLLMTLIGTLLAAIHFTSAPKPGSKTLPQ* |
| JGI12053J15887_105383102 | 3300001661 | Forest Soil | MGCNGAAEKDMKIYLLMLLIGSLLAAIHFTSAPEQPSKTLPQ* |
| JGI25612J43240_10066192 | 3300002886 | Grasslands Soil | VGVKAAGAAEKEMKIYLLMVLIGTLLTAIRVTSVPKQQSKTLPNS* |
| JGI25615J43890_10729392 | 3300002910 | Grasslands Soil | ALWSLLDCNAAAGKNMKIYLLMALIGTLLTAIHFTSAPEQQSKTLPQ* |
| JGI25617J43924_100694952 | 3300002914 | Grasslands Soil | LKPVLGCNGAAEKPMKIYLLMALIGILLAAVRFTSAPEQRSKTLPQ* |
| JGI25616J43925_100233582 | 3300002917 | Grasslands Soil | VKAADAAEKDMKVYLLMVLIGTLLTAIRFPSVPKQQSKTLPNS* |
| JGI25406J46586_100013808 | 3300003203 | Tabebuia Heterophylla Rhizosphere | LLRHSCIGAAESDMKIYLLIMLIGTLLAAVHFTSAAEQPSETLPQ* |
| JGI25406J46586_101306552 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MPFALLRHSCNGAAESDMKIYLLIMLIGTLLAAVHFTSATEQPSETLPQ* |
| JGI25404J52841_100095822 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MPFASLRGSCNGAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPR* |
| Ga0062385_110948711 | 3300004080 | Bog Forest Soil | MRLFNRLQDAAEKSMKIYLLLLLMSALLTAVHFTSAPEQRSKTLSQ* |
| Ga0063454_1007414482 | 3300004081 | Soil | LKGGTPFALPRYSCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEQPSETLPQ* |
| Ga0062593_1010190782 | 3300004114 | Soil | GCNGAAESDMKIYLLIMLIGALLTAVHFTSTPKRQPETLPQ* |
| Ga0062593_1025801972 | 3300004114 | Soil | GCNGAAESDMKIYLLIMLIGALLTAVHFTSTPKQQPETLPQ* |
| Ga0062593_1026955461 | 3300004114 | Soil | GCNGAAESDMKIYLLIMLIGTLLTAVHFTSAPKRQPETLPQ* |
| Ga0063455_1006560381 | 3300004153 | Soil | QGCNGAAESDMKIYLLIMLIGSLLAAIHFTSAPKHQSETLPQ* |
| Ga0062595_1004927151 | 3300004479 | Soil | VGCNGAAEKDMKIYLLMMIIGTLLTAIHFTSAPKQGSKSLPQ* |
| Ga0062595_1007972772 | 3300004479 | Soil | LESGTTGTPFAFAAHSCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEKASETLPQ* |
| Ga0066823_100706422 | 3300005163 | Soil | VERRLHCRGGCNGAAESDMKIYLLIMLIGTLLAAVHFTSAADQPPETLPQ* |
| Ga0066683_100748594 | 3300005172 | Soil | MVQWRKSMKIYLLLVLMGTLLAAIRVTSVPEQRSETLPQ* |
| Ga0066688_100144082 | 3300005178 | Soil | LYSSEGCNGAAEKNMKIYLLLLLMGALFAAIRVTSVPQQRSETLPQ* |
| Ga0066684_106316972 | 3300005179 | Soil | LYSSEGCNGAAEKNMKIYLLLLLMGALFAAIRVTSVPEQRSETLPQ* |
| Ga0070676_103960042 | 3300005328 | Miscanthus Rhizosphere | GCNGAAESDMKIYLLIMLIGSLLAAIHFTSAPKRQSETLPQ* |
| Ga0066388_1011376121 | 3300005332 | Tropical Forest Soil | MPFALLRDSCNGAAESDMKIYLLIMLIGTLLAAVRFTSAAEQPAETLPQ* |
| Ga0066388_1016195052 | 3300005332 | Tropical Forest Soil | MPFALLPGSCIAAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPR* |
| Ga0066388_1042548572 | 3300005332 | Tropical Forest Soil | VCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0066388_1079456372 | 3300005332 | Tropical Forest Soil | MTQRSKDMKIYLLMFLIGTILTAIRFTSAPKQGSETLPQ* |
| Ga0070680_1017191632 | 3300005336 | Corn Rhizosphere | MAQRRLIMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0070671_1020252832 | 3300005355 | Switchgrass Rhizosphere | QTLKLQWRSGTDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0070674_1008334982 | 3300005356 | Miscanthus Rhizosphere | CQSCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0070709_106505731 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IGVKAAGAAEKDMKAYVLMVLIGTLLTAIRFTSVPKQQSKTLPNS* |
| Ga0070705_1005253921 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VKAAGAAEKDMKVYLLMVLIGTLLTAIRFTSMPKQPSKTLPNS* |
| Ga0066682_102183692 | 3300005450 | Soil | LYSPEGCNGAAEKNMKIYLLLLLMGALFAAIRVTSVPQQRSETLPQ* |
| Ga0070678_1012349292 | 3300005456 | Miscanthus Rhizosphere | MPFALPAGSCNGAVECDMKIYLLILLIGTLLAAVHFTSASEQPSETLPQ* |
| Ga0068867_1017251591 | 3300005459 | Miscanthus Rhizosphere | SCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0077121_107228291 | 3300005511 | Arabidopsis Rhizosphere | RLLHCRRYGCNGAAETDMKIYLLILLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0068855_1010476431 | 3300005563 | Corn Rhizosphere | AAESDMKIYLLVMIIGSLLTAIHFTSAPKQPDRLPQ* |
| Ga0068855_1011138682 | 3300005563 | Corn Rhizosphere | MSGTGAAEDGMKIYLLMLLIGSLLAAIRFTSAPEQRSKSLQ* |
| Ga0068854_1002446183 | 3300005578 | Corn Rhizosphere | LHCCALLGCNVAAEKDKKIYLLMLLIGALLTAVHFTSAPEQRSKTLPQ* |
| Ga0068852_1000080011 | 3300005616 | Corn Rhizosphere | KDMKIYLLMVLFGTLLTAIHFTSAQERRSKSLQQ* |
| Ga0068852_1025611942 | 3300005616 | Corn Rhizosphere | AAENDMKIYLLMMLIGALLTATHFTSARETGSKSLPQ* |
| Ga0066905_1022712341 | 3300005713 | Tropical Forest Soil | MPFALLRGSCNCAAENYMKIYLLIMLIGTLLAAVHFTSASEKPSETLPQ* |
| Ga0066903_1009320362 | 3300005764 | Tropical Forest Soil | MPFALLRGSCNAAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPQ* |
| Ga0066903_1020133032 | 3300005764 | Tropical Forest Soil | LQGCDNAAGTIMKIYLLVLLIGALLAAIHFTSAPEQPSQSLQQ* |
| Ga0068870_113457351 | 3300005840 | Miscanthus Rhizosphere | CNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0068863_1018464222 | 3300005841 | Switchgrass Rhizosphere | LHCSRSCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEKASETLPQ* |
| Ga0068860_1027470921 | 3300005843 | Switchgrass Rhizosphere | GCNGAAESDMKIYLLIMLIGTILTAVHFTSAPKRQPETLPQ* |
| Ga0081455_100260745 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPFALLRGGCNGAAESDMKIYLLIMLIGTLLTAVHFTSASEQPSKTLPQ* |
| Ga0081540_10174272 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MPFALLRGSCNGAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPR* |
| Ga0081540_11188981 | 3300005983 | Tabebuia Heterophylla Rhizosphere | SDMKIYLLIMLIGTLLAAVHFTSASEQQSETLPQ* |
| Ga0080027_102569182 | 3300005993 | Prmafrost Soil | MKIYLLMTLIGTLLTAIHFTSATTVPEQRSKPRPQ* |
| Ga0066652_1001713764 | 3300006046 | Soil | EGCNGAAEKNMKIYLLLLLMGALFAAIRVTSVPQQRSETLPQ* |
| Ga0075363_1007740631 | 3300006048 | Populus Endosphere | GSLLHCRCQSCNGAAETDMKIYLLIMLIGSLLAAIHFTSTPKQQSETLPQ* |
| Ga0075028_1000744471 | 3300006050 | Watersheds | CSDRAEQDMKIYLLMTLIGTLLIAIHFTSAPKQSSKTLSQ* |
| Ga0075028_1000912724 | 3300006050 | Watersheds | CNGAAEKVMKIYLLVMLIGTLLTAIHFTSAPKPGSKGLPQ* |
| Ga0075017_1009027692 | 3300006059 | Watersheds | DRAGQDMKIYLLMTLIGTLLIAIHFTSAPKQSSKTLSQ* |
| Ga0075019_109663391 | 3300006086 | Watersheds | VCNDRAGHDMKIYLLMTLIGTLLIAIHFTSAPKQSSKTLPQ* |
| Ga0070765_1008204081 | 3300006176 | Soil | EQDMKIYLLMALIGTLLTAIHFTSTPKQPSKTLPQ* |
| Ga0075021_104452582 | 3300006354 | Watersheds | DDRAGQDMKIYLLMSLIGILLIAIHFTSTPKQSSKTLPQ* |
| Ga0074055_110598392 | 3300006573 | Soil | LLRHGCNGAAESDMKIYLLIMLIGTLLAAVHFTSAAEQPSETLPQ* |
| Ga0079221_110432661 | 3300006804 | Agricultural Soil | MPFALLRHSCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEQKSETLPQ* |
| Ga0079221_115764091 | 3300006804 | Agricultural Soil | LSWAANFCAGQAMKIYLLLALIGTLFVAIHLTSAPKRDSNTLPQ* |
| Ga0079220_105329881 | 3300006806 | Agricultural Soil | AAENDMKIYLLMMIIGTLLTAVHFTSAPKPQSKPLQQ* |
| Ga0075433_112264792 | 3300006852 | Populus Rhizosphere | ECLLHCRCQSCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0075433_112809192 | 3300006852 | Populus Rhizosphere | NGICIASLQGCDNAAGTVMKIYLLVLLIGALLAAIHFTSAPEQPSQSLQQ* |
| Ga0075425_1000073791 | 3300006854 | Populus Rhizosphere | TVMKIYLLVLLIGALLAAIHFTSAPEQPSQSLQQ* |
| Ga0075434_1005547632 | 3300006871 | Populus Rhizosphere | MPFALLRGSCNGAAENYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPQ* |
| Ga0101947_10289202 | 3300006872 | Drinking Water Pipes | MDLKLYLLIMLIGTLLAAVRLTSASEQRSETLPQ* |
| Ga0068865_1003767743 | 3300006881 | Miscanthus Rhizosphere | QSCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0075424_1011521812 | 3300006904 | Populus Rhizosphere | MPFALLRGSCNGAAENYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPR* |
| Ga0075436_1005308672 | 3300006914 | Populus Rhizosphere | MPFALLRDGCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEQPSETLPR* |
| Ga0066710_1009390271 | 3300009012 | Grasslands Soil | AETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0066710_1031419552 | 3300009012 | Grasslands Soil | MAQPESDMDLKLYLLIMLIGTLLAAVHFTSASEQPSETLPQ |
| Ga0099829_105078642 | 3300009038 | Vadose Zone Soil | LEGCNGAAEKNMKIYLLLVLIGTLLAAIHFTSEPEQQSKTLPNS* |
| Ga0066256_100060830 | 3300009070 | Wastewater Bioreactor | MAGMKIYLLMLLIGALFTAIHFTSIPDAGSKSLPQ* |
| Ga0099830_112245512 | 3300009088 | Vadose Zone Soil | VKAAGAAEKDMKIYLLMVLIGSLLTAIRVTSVPKQQSKTLPNS* |
| Ga0099830_116874012 | 3300009088 | Vadose Zone Soil | ALRSLSGCNGAAEKDMKIYLLMLLIGALLTAIHFTSAPEQSKTRPQ* |
| Ga0099828_102237514 | 3300009089 | Vadose Zone Soil | CNAAAGKNMKIYLLMALIGTLLTAIHFTSAPEQQSKTLPQ* |
| Ga0105247_110994391 | 3300009101 | Switchgrass Rhizosphere | RQGCNGAAESDMKIYLLIMLIGALLTAVNFTSAPKRQSETLPQ* |
| Ga0066709_1023523791 | 3300009137 | Grasslands Soil | AETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0099792_109313601 | 3300009143 | Vadose Zone Soil | MAQRREEMKIYLLMAIIGTLLTAIHFTSAPKQGSKTLPQ* |
| Ga0105243_109917041 | 3300009148 | Miscanthus Rhizosphere | AAESDMKIYLLIMLIGSLLAATHFTSTPKRQSETLPQ* |
| Ga0105248_106797333 | 3300009177 | Switchgrass Rhizosphere | DAAETAMKIYLLILLIGALLTAVHFTSGPEKSPETLPQ* |
| Ga0115920_11924061 | 3300009347 | Swimming Pool Sandfilter Backwash | GAAESDLKISLLIMLIGTLLAAVHFTSASERQSETLPQ* |
| Ga0105858_12146881 | 3300009661 | Permafrost Soil | EKEMKIYLLMMLIGTLLTAVHFTSTPEQRSKTLP* |
| Ga0126374_102767742 | 3300009792 | Tropical Forest Soil | MPFALLRGSCNGAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPQ* |
| Ga0126380_108159472 | 3300010043 | Tropical Forest Soil | MVAGCNVAAENDMKIYLLMLLIGTLLAAVHFTSVPKKPSKSLQQ* |
| Ga0126380_111881322 | 3300010043 | Tropical Forest Soil | MDPKIYLLIMLIGTLLAAVRFTSASKQPSETLPQ* |
| Ga0126380_116451052 | 3300010043 | Tropical Forest Soil | MPFALLRGSCNAAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPR* |
| Ga0126382_118973401 | 3300010047 | Tropical Forest Soil | MPFALLRDSCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEKASETLPQ* |
| Ga0133945_1178561 | 3300010050 | Xenic Strain | NGAAESVMKIYLLIMLIGTLLAATHFTSAPKRQSETLPQ* |
| Ga0136445_10017816 | 3300010207 | Littoral | LQSTIDIGIGCNGAAESKMKIYLLMTLIGAILTAVHLTTVPERKSETLPQ* |
| Ga0134067_103685311 | 3300010321 | Grasslands Soil | NGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0126376_123655012 | 3300010359 | Tropical Forest Soil | MPFALLRDSCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEQQSETLPQ* |
| Ga0126379_124741222 | 3300010366 | Tropical Forest Soil | SCNGAAESNMKIYLLIMLIGTLLAAVHFTSASEQQSETLPQ* |
| Ga0134125_101830363 | 3300010371 | Terrestrial Soil | MERLWHRGGAAERDMKIYLLMILIGALLTAIHFTSAPKPQSETLPH* |
| Ga0134124_111050082 | 3300010397 | Terrestrial Soil | LLRHGCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEKASETLPQ* |
| Ga0134121_102549434 | 3300010401 | Terrestrial Soil | GAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0134121_103802522 | 3300010401 | Terrestrial Soil | LVNCNEAAEKAMKIYLLILLIGALLTAVHFTSAPEKRPETQPQ* |
| Ga0134123_120732451 | 3300010403 | Terrestrial Soil | AAETDMKIYLLIMLIGSLLAAIHFTSTPKQQSETLPQ* |
| Ga0126356_110895494 | 3300010877 | Boreal Forest Soil | SLLGCNAAAEKDMKIYLLMALIGILLTAIHFTSAPEQQSKTLPQ* |
| Ga0105246_101660524 | 3300011119 | Miscanthus Rhizosphere | AAESDMKIYLLIMLIGSLLAAIHFTSAPKRQSETLPQ* |
| Ga0137392_102492924 | 3300011269 | Vadose Zone Soil | VKAAGAAEKEMKIYLLMVLIGTLLTAIRVTSVPKQQSKTLPNS* |
| Ga0137392_105914191 | 3300011269 | Vadose Zone Soil | KDMKIYLLMALIGALLTAIHFTSVPEQRSETLPQ* |
| Ga0137388_103477381 | 3300012189 | Vadose Zone Soil | LRSLSGCNGAAEKDMKIYLLMLLIGALLTAIHFTSAPEQSKTRPQ* |
| Ga0150985_1058018691 | 3300012212 | Avena Fatua Rhizosphere | ENDMKIYLLIMLIGALLTAVHFTSVPEQRSKTLPQ* |
| Ga0150985_1149877432 | 3300012212 | Avena Fatua Rhizosphere | ALPWLTCCNGAAENDMKIYLLIMLIAALLTAVHFTSVPEQRSKRLPQ* |
| Ga0137371_102961932 | 3300012356 | Vadose Zone Soil | MVQWRKSMKIYLLLVLMGTLLAAIRVTSVPEQRSETLPQ |
| Ga0150984_1126496391 | 3300012469 | Avena Fatua Rhizosphere | AAENDMKIYLLIMLIAALLTAVHFTSVPEQRSKRLPQ* |
| Ga0137358_105371322 | 3300012582 | Vadose Zone Soil | LSLEGCNGAVEKNMKIYLLMVLIGTLLAAIRFTSVPDQQSKTLPNS* |
| Ga0137397_108574652 | 3300012685 | Vadose Zone Soil | MKAAEAAEKDMKIYLLMALIGTLLTAIRVTSVPKQQSKTLPNS* |
| Ga0157284_103225611 | 3300012893 | Soil | HCRRQSCNGAAESDMKIYLLIMLIGSLLATIHFTSAPKQQSETLPQ* |
| Ga0157296_103060591 | 3300012905 | Soil | SLLHCRRQSCNGAAESDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ* |
| Ga0157295_103017401 | 3300012906 | Soil | SDMKIYLLIMLIGALLTAVHFTSTPKRQPETLPQ* |
| Ga0137396_105846322 | 3300012918 | Vadose Zone Soil | AAETDMKIYLLIMLIGSLLAAIRFTSAPNQQSETLPQ* |
| Ga0137394_115621851 | 3300012922 | Vadose Zone Soil | AEKYMKIYLLILLIGALLTAIHFTSAPERSKTLPQ* |
| Ga0137413_116002762 | 3300012924 | Vadose Zone Soil | LQRLQWAAEKNMRIYLLMALIGTLLTAIRVTSVPKQQSKTLPNS* |
| Ga0137404_120249692 | 3300012929 | Vadose Zone Soil | LSGCNDAAEKEMKIYLLMTLIGALLTAVRFTSTPKSQSKRLPQ* |
| Ga0164241_105579662 | 3300012943 | Soil | MAQRRLIMKIYLLIMLIGSLLAAIHFTSTPKQQSETLPQ* |
| Ga0137410_116853281 | 3300012944 | Vadose Zone Soil | MPIALWSLSGCNAAAGKNMKIYLLMALIGTLLTAIHFTSAPEQ |
| Ga0126375_103566832 | 3300012948 | Tropical Forest Soil | MPFALLRGSCNFAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPQ* |
| Ga0164300_100086762 | 3300012951 | Soil | VKAAGAAEKDMKAYVLMVLIGTLLTAIRFTSVPKQQSKTLPNS* |
| Ga0164298_104216742 | 3300012955 | Soil | VKAAGAAEKDMKVYLLMALIGTLLTTIRFTSAPKQQS |
| Ga0126369_103135841 | 3300012971 | Tropical Forest Soil | KVMKIYLLMLLIGTILTAIRFTSVPEQRSKSLPQ* |
| Ga0164308_116163201 | 3300012985 | Soil | RGGCNGAAESDMKIYLLIMLIGTLLAAVHFTSAADQPPETLPQ* |
| Ga0164304_114383431 | 3300012986 | Soil | GKNMKIFLLMVLIGTLLTMIRFNSVSEQQSKTLPNS* |
| Ga0157373_112952172 | 3300013100 | Corn Rhizosphere | MAQPENCGDAAESDMKIYLLVMIIGSLLTAIHFTSTPRQPDRLPQ* |
| Ga0157369_114080511 | 3300013105 | Corn Rhizosphere | NGAAENDMKIYLLVMLIGTLLAAVHFTSVPKKQSKSLQQ* |
| Ga0181517_100369752 | 3300014160 | Bog | MSLASQPQLRLRAAEKDMKIYLLVLLIGTLLTAIHFTSAPKQPSETLPQ* |
| Ga0181532_100425496 | 3300014164 | Bog | TEQDMKIYLLMALIGTLLTVIRFTSAPEQPSKSLPQ* |
| Ga0181528_100505082 | 3300014167 | Bog | MSLASQLLLRWRAAEKDMKIYLLVLLIGTLLTAIHFTSAPKQPSETLPQ* |
| Ga0181537_104904672 | 3300014201 | Bog | MHDAAERVMKIYLLMVLIGTLLTAIHFTSAPEQQRSKSLPQ* |
| Ga0157380_125395262 | 3300014326 | Switchgrass Rhizosphere | AAEKDMKIYLLIMVIGALLTAIHFTSVQDQQSETLPQ* |
| Ga0182014_100220226 | 3300014491 | Bog | LLRLRAAEKDMKIYLLVLLIGTLLTAIHFTSAPKQPSETLPQ* |
| Ga0182016_102565562 | 3300014493 | Bog | LGCQQQRASEKDMKIYLLMMLIGALLTAVNFNAAPKPGSKTISQ* |
| Ga0182008_101048101 | 3300014497 | Rhizosphere | AGQAMKIYLLLALIGTLFVAIHFTSAPKRDSNTLPQ* |
| Ga0182024_107670932 | 3300014501 | Permafrost | VVVSCNGAAENDMKAYLLMMLIGAIFTAIHFTSAPKPGSKTLPR* |
| Ga0182030_110225251 | 3300014838 | Bog | KSAAEHDMKIYLLMALIGILLTAVNFTSLPKRRSKTLSQ* |
| Ga0167636_10296731 | 3300015075 | Glacier Forefield Soils | AALVGCNGAAEKDMKIYLLMTIIGTLLTAIHFTSAPKQGSKTLPQ* |
| Ga0167637_10046663 | 3300015087 | Glacier Forefield Soil | LQSLSGCNEAAEKDMKIYLLMMLIGALLTAVHFTSAPEKRPETLPQ* |
| Ga0132258_128962252 | 3300015371 | Arabidopsis Rhizosphere | MDMKIYLLLMLIGTILIAANLTSASEQPSKTLPQ* |
| Ga0132256_1000933484 | 3300015372 | Arabidopsis Rhizosphere | LLRGSCNGAAENYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPR* |
| Ga0132256_1002573151 | 3300015372 | Arabidopsis Rhizosphere | MPFALLLGSCNGAAESYMKIYLLIMLIGTLLAAVHFTSASEQPS |
| Ga0132256_1003426941 | 3300015372 | Arabidopsis Rhizosphere | MPFALLRDGCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEQPS |
| Ga0182036_107178251 | 3300016270 | Soil | KGCDGAAEKDMKIYLLMLLIGAILTAVQFSSAPEQQSKSLKQ |
| Ga0182037_108997861 | 3300016404 | Soil | HSAEQAMKIYLLLTLIGTLLTAVHFTSAPKQNSKTLPQ |
| Ga0187875_105020752 | 3300018035 | Peatland | MHFALRLSFWASLGCNDATEQDMKIYLLMALIGTLLTVIRFTSAPEQPSKSLPQ |
| Ga0184626_100172052 | 3300018053 | Groundwater Sediment | MRSLLGCNAAAGKDMKIYLLMTLIGALLTAIHFTSAPEQQSKTLPQ |
| Ga0184619_101860171 | 3300018061 | Groundwater Sediment | IGSAGTPFALLRHGCNGAAECDMKIYLLIMLIGTLLAAVHFTSAPDRQSETLPQ |
| Ga0184619_105327752 | 3300018061 | Groundwater Sediment | CNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0184609_101391391 | 3300018076 | Groundwater Sediment | QSNGTPIALWSLLDCNAAAGKTMKIYLLMALIGTLLTAIHFTSAPDQQSKTLPQ |
| Ga0187772_110858481 | 3300018085 | Tropical Peatland | SWPGCSETAETDMKIYLLMLLIGTILTAVRFTSAPKQRSETLPQ |
| Ga0190268_120656162 | 3300018466 | Soil | ETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0190264_100072704 | 3300019377 | Soil | LRAGTSFALQTLSCNGAAETDMKIYLLIMLIGSLLAAIHFTSTPKQHSETLPQ |
| Ga0190264_108430712 | 3300019377 | Soil | NGAAESDMKIYLLIMLIGTILTAVHFTSAPERQPERLPQ |
| Ga0193728_11371032 | 3300019890 | Soil | LQSLSGCNGAAEKYMKIYLLILLIGALLTAIHFTSAPEPSKTLPQ |
| Ga0193730_10744792 | 3300020002 | Soil | SNGTPIALWSLLGCNAAAGKNMKIYLLMALIGTLLTAIHFTSAPDQQSKTLPQ |
| Ga0193755_11380052 | 3300020004 | Soil | GKNMKIYLLMALIGTLLTAIHFTSAPEQQSKTLPQ |
| Ga0193753_102216652 | 3300020034 | Soil | MGCNGAAEKDMKIYLLMLLIGSLLAAIHFTSAPEQPSKTLPQ |
| Ga0193716_10912302 | 3300020061 | Soil | MHDAAEPVMKIYLLMVLIGTLLTAIHFTSAPEQQRSKSLPQ |
| Ga0179590_10105022 | 3300020140 | Vadose Zone Soil | VGVKAAGAAEKEMKIYLLMVLIGTLLTAIRVTSVPKQQSKTLPNS |
| Ga0210407_110222002 | 3300020579 | Soil | CNDAAEQDMKIYLLMALIGILFTAIHFTSAPKQRSKTLPR |
| Ga0210403_104833002 | 3300020580 | Soil | MAANDAAENDMKVYLLMTLIGTLLAAIHFTSAPKQGSKTLPH |
| Ga0210401_106974382 | 3300020583 | Soil | AAEKVMKIYLLVMLIGTLLAAIHFTSAPKQDSNSLPQ |
| Ga0210406_104973532 | 3300021168 | Soil | LCCNGAAEKVMKIYLLVMLIGTLLAAIHFTSAPKQDSNSLPQ |
| Ga0210408_101777361 | 3300021178 | Soil | QPQPDCNDTPGQDMKIYLLIMLIGILLTAIHFTSAPEQPSKTLPR |
| Ga0210408_114262102 | 3300021178 | Soil | LGRNRAAEQDMKIYLLMGLIGTLLTAIHFTSAPKQPSKTLPQ |
| Ga0210385_109792281 | 3300021402 | Soil | DRAGQDMKIYLLMTLIGTLLIAIHFTSTPKRSSKTLQQ |
| Ga0210397_100589415 | 3300021403 | Soil | AGQDMKIYLLMTLIGTLLIAIHFTSTPKRSSKTLQQ |
| Ga0210397_102632261 | 3300021403 | Soil | AEKDMKIYLLMMLIGALLAATHFTSAREQGSKSLPQ |
| Ga0210387_109342832 | 3300021405 | Soil | GCNGAAEKDMKIYLLMTLIGTLLTAIHFTSAPKQGSKTLQQ |
| Ga0210383_112732952 | 3300021407 | Soil | NVFALRLLSGCDEQRGKDMKIYLLMLLIGSLLTAIHFTSTPEQGSKPNPQ |
| Ga0213852_14127721 | 3300021858 | Watersheds | AEKVMKIYLLVMLIGTLLTAIHFTSAPKRGSKSLPQ |
| Ga0242665_100411153 | 3300022724 | Soil | YHSAEQVMKIYLLLALIGTLLTAIHFTSAPKQNSKTLPQ |
| Ga0222622_103070993 | 3300022756 | Groundwater Sediment | LAGSLLHCRCQSCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0222622_109812582 | 3300022756 | Groundwater Sediment | LLHCRCQSCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0247770_11257941 | 3300022891 | Plant Litter | SGGSLLHCRRQSCNGAAESDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0233356_10468782 | 3300023046 | Soil | MSFALQSLSGCNEAAEKDMKIYLLMMLIGALLTAVHFTSAPE |
| Ga0207710_105208371 | 3300025900 | Switchgrass Rhizosphere | RQGCNGAAESDMKIYLLIMLIGALLTAVNFTSAPKRQSETLPQ |
| Ga0207705_106771892 | 3300025909 | Corn Rhizosphere | LFGCNGAAENDMKIYLLIMLIGALLTAVHFTSTPERRPETLPQ |
| Ga0207707_101782371 | 3300025912 | Corn Rhizosphere | RLIMKIYLLIMLIGSLLAAIHFTSTPKQQSETLPQ |
| Ga0207660_105028502 | 3300025917 | Corn Rhizosphere | MAQRRLIMKIYLLIMLIGSLLAAIHFTSTPKQQSETLPQ |
| Ga0207660_105951942 | 3300025917 | Corn Rhizosphere | AEINMKIYLLMMLIGTLLTLVHFTSAPEQRSKSLRQ |
| Ga0207649_110026642 | 3300025920 | Corn Rhizosphere | SCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0207694_111769952 | 3300025924 | Corn Rhizosphere | MPFALPAGSCNGAVECDMKIYLLILLIGTLLAAVHFTSAAEQPSETLPQ |
| Ga0207700_115617271 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MGFVAGCDIAAGKDMKIYLLMLLIGALLAATRFTSAREQS |
| Ga0207644_105094842 | 3300025931 | Switchgrass Rhizosphere | MAQRRLIMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0207669_104653382 | 3300025937 | Miscanthus Rhizosphere | LLHCRRQSCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0207704_106205061 | 3300025938 | Miscanthus Rhizosphere | SRSCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEKASETLPQ |
| Ga0207667_107026341 | 3300025949 | Corn Rhizosphere | SCNGAAETDMKIYLLIMLIGSLLAAIHFTSTPKQQSETLPQ |
| Ga0207640_111184261 | 3300025981 | Corn Rhizosphere | LHCCALLGCNVAAEKDKKIYLLMLLIGALLTAVHFTSAPEQRSKTLPQ |
| Ga0207677_104587593 | 3300026023 | Miscanthus Rhizosphere | AAESDMKIYLLIMLIGSLLAATHFTSTPKRQSETLPQ |
| Ga0207639_113968022 | 3300026041 | Corn Rhizosphere | AAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0207683_104242093 | 3300026121 | Miscanthus Rhizosphere | RQSCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0209849_10682432 | 3300026215 | Soil | MKIYLLMTLIGTLLTAIHFTSVTTVPEQRSKPRPQ |
| Ga0209240_10134956 | 3300026304 | Grasslands Soil | LKPVLGCNGAAEKPMKIYLLMALIGILLAAVRFTSAPEQRSKTLPQ |
| Ga0209647_10417713 | 3300026319 | Grasslands Soil | LKPVLGCNGAAEKPMKIYLLMAAVRFTSAPEQRSKTLPQ |
| Ga0209267_11580332 | 3300026331 | Soil | LYSSEGCNGAAEKNMKIYLLLLLMGALFAAIRVTSVPQQRSETLPQ |
| Ga0209158_13135712 | 3300026333 | Soil | LYSSEGCNGAAEKNMKIYLLLLLMGALFAAIRVTSVPEQRSETLPQ |
| Ga0257170_10274922 | 3300026351 | Soil | VKAAGAAEKEMKIYLLMVLIGTLLTAIRVTSVPKQQSKTLPNS |
| Ga0257169_10494881 | 3300026469 | Soil | MPIALWSLSGCNAAAGKNMKIYLLMALIGILLTAIHFTSAPEQQSETLPQ |
| Ga0257169_10772102 | 3300026469 | Soil | SLLGCNAAAGKDMKIYLLMALIGILLTAIHFTSAPEQQSETLPQ |
| Ga0209378_11510712 | 3300026528 | Soil | LYSPEGCNGAAEKNMKIYLLLLLMGALFAAIRVTSVPQQRSETLPQ |
| Ga0179587_107685352 | 3300026557 | Vadose Zone Soil | LLSWSGCNGAAEKEMKIYLLMALIGALLTAVHFTSTPKQQSKTHPQ |
| Ga0207740_10341312 | 3300027011 | Tropical Forest Soil | EQAMKIYLLLTLIGTLLTAIHFTSAPKQNSKTLPQ |
| Ga0209215_10299591 | 3300027266 | Forest Soil | MPFALLRGSCNGAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPQ |
| Ga0209213_10112334 | 3300027383 | Forest Soil | EKDMKIYLLMALIGTLLTAIHFTSAPEQQSKTLPQ |
| Ga0208995_10495262 | 3300027388 | Forest Soil | MPFALWSSGCKGAAENVMKIYLLMLLIGTLLTAIHFTSAP |
| Ga0208985_10460251 | 3300027528 | Forest Soil | MRLFSGLQEAAEKNMKIYLLILLIGALLTAVHFTSAPEQRSKTLSQ |
| Ga0209222_11154922 | 3300027559 | Forest Soil | NGAAEKEMKIYLLMLLIGTLLTAVHFTSTPEQGPKTLP |
| Ga0209528_10260051 | 3300027610 | Forest Soil | AEKEMKIYLLMALIGALLTAVHFTSPPKQQSKTLPQ |
| Ga0209388_11587352 | 3300027655 | Vadose Zone Soil | KEMKIYLLMVLIGTLLTAIRVTSVPKQQSKTLPNS |
| Ga0208981_11280781 | 3300027669 | Forest Soil | SFNGAAGKDMKIYLLITLIGALLTAVHFTSTPEQRSKTLPQ |
| Ga0209795_101799792 | 3300027718 | Agave | PSCNGAAESDMKIYLLIMLIGTLLAAVHFTSATEQPSETLPQ |
| Ga0209274_107079761 | 3300027853 | Soil | AEKEMKIYLLMLLIGTLLTAVHFTSTPEQGPKTLP |
| Ga0209477_11783142 | 3300027959 | Activated Sludge | VEKDMKIYLLVMLIGALLTAIHFTSAPDQRSETLPQ |
| Ga0302145_100272681 | 3300028565 | Bog | NGLCIAVSGCTGAAEKDMKIYLLMMLIGILLTAVHFTSAPEQRSKTLP |
| Ga0307504_100450203 | 3300028792 | Soil | AESDMKIYLLIMLIGALLTAVHFTSAPKRQSETLPQ |
| Ga0307503_100362761 | 3300028802 | Soil | NGAAESDMKIYLLIMLIGALLTAVHFTSTPKRQPETLPQ |
| Ga0307302_103174782 | 3300028814 | Soil | LQRLQWAAEKNMKIYLLMALIGTLLTAIRVTSVPKQQSKTLPNS |
| Ga0307296_106899842 | 3300028819 | Soil | AETDMKIYLLIMLIGSLLAAIHFTSTPKQQSETLPQ |
| Ga0302146_101495031 | 3300028867 | Bog | KDMKIYLLMLLIGTLLTAIHFTSAPKQPSETLPQQ |
| Ga0222749_107124682 | 3300029636 | Soil | FYKVFNRLKGAAEQAMKIYLLMALIGIILTAVHFTSMPEQR |
| Ga0311331_110996252 | 3300029954 | Bog | MKIYLLVTLIGTLLTAIHFTSAPEQRSKANPQAKPLNS |
| Ga0311365_113243642 | 3300029989 | Fen | VNAAAEEDMKIYLLMMLMCSLFAAIHFTSAPRKQSGTQPQ |
| Ga0311336_101631104 | 3300029990 | Fen | QRLSGCNGAAEKDMKIYLLMTIIGTLLTAIHFTSAPKQGSKTLPQ |
| Ga0311336_120247421 | 3300029990 | Fen | GAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSKTLPQ |
| Ga0302179_101969522 | 3300030058 | Palsa | MAQRGDDMKIYLLMMLIGTLLTAIHFTSTPEQRSKTLP |
| Ga0302211_101036111 | 3300030491 | Fen | LQRLSGCNGAAEKDMKIYLLMTIIGTLLTAIHFTSAPKQ |
| Ga0311370_102896454 | 3300030503 | Palsa | AAERHMKIYLLMLLIGAILTAVHFTSAPEQGSKTLPQ |
| Ga0308198_10779182 | 3300030904 | Soil | AGSLLHCRCQSCNGAAETDMKIYLLIMLIGSLLAAIHFTSAPKQQSETLPQ |
| Ga0311366_114456182 | 3300030943 | Fen | ETDMKIYLLIMLIGSLLAAIHYTSAPKQRSETLPQ |
| Ga0308197_101389522 | 3300031093 | Soil | SLLGCNAAAGKNMKIYLLMALIGTLLTAIHFTSAPDQQSKTLPQ |
| Ga0307501_101166032 | 3300031152 | Soil | AGTPFALLRHGCNGAAESDMKIYLLIMLIGSLLAAVHFTSAPERQSETLPQ |
| Ga0307498_100122293 | 3300031170 | Soil | VERRLHCRGGCNGAAESDMKIYLLIMLIGTLLAAVHFTSAADQPPETLPQ |
| Ga0170824_1015436651 | 3300031231 | Forest Soil | MECVLLGGRWGCNGAAENDMKIYLLMMLIGTLLAAIRFTSVPEQPSKTLPQ |
| Ga0170824_1154315641 | 3300031231 | Forest Soil | CIAIGAKAADAAEKDMKVYLLMVLIGTLLTAIRFTSVRVQQQSKTLPKS |
| Ga0302323_1021942092 | 3300031232 | Fen | VNAAAEEDMKIYLLMMLMCSLFAAIHFTSAPRKQSGTQTQ |
| Ga0302324_1007234493 | 3300031236 | Palsa | AGCNSTAEKDMKIYLLMMLIGSILTAVHFTSNPEPQPKTPPQ |
| Ga0265328_103024612 | 3300031239 | Rhizosphere | LCCNGAAEKIMKIYLLVMLIGTLLTAIHFTSAPKQDSNSLPQ |
| Ga0307506_100475521 | 3300031366 | Soil | LHFSRLGCNGAAESDMKIYLLIMLIGALLTAVHFTSTPKRQPETLPQ |
| Ga0170818_1005535421 | 3300031474 | Forest Soil | NGAAGKNMKIYLLMVLIGVLLTAIHFTSVPEQGSKTLPQ |
| Ga0302320_103416754 | 3300031524 | Bog | IYLLMTLIGTLLTAIHFTSAPEQRSKANPQAKPLNS |
| Ga0265342_101744923 | 3300031712 | Rhizosphere | GAAEKVMKIYLLVMLIGTLLTAIHFTSAPKPGSKGLPQ |
| Ga0307469_107822942 | 3300031720 | Hardwood Forest Soil | MPFALLSGSCNGAAESYMKIYLLIMLIGTLLAAVHFTSA |
| Ga0311351_108691831 | 3300031722 | Fen | AEKDMKIYLLMTIIGTLLTAIHFTSAPKQGSKSLPQ |
| Ga0307516_106493962 | 3300031730 | Ectomycorrhiza | VEKDMKIYLLVMLIGALLTAIHFTSVPDQRSETLPQ |
| Ga0307468_1001299262 | 3300031740 | Hardwood Forest Soil | MPFALLRGSCNCAAESYMKIYLLIMLIGTLLAAVHFTSASEQPSETLPR |
| Ga0307478_104287183 | 3300031823 | Hardwood Forest Soil | AQRGTEMKIYLLMLLIGTLLTAIHFTSTPEQRSKTLP |
| Ga0306919_112744821 | 3300031879 | Soil | NHTAEQAMKIYLLLTLIGTLLTAVHFTSAPKQNSKTLPQ |
| Ga0306925_103105822 | 3300031890 | Soil | LTPLEGCNEAGESAMKIYLLMLVMGTLLAAIRLTSAPKQQSNSLPQ |
| Ga0302322_1021778931 | 3300031902 | Fen | AESDMKIYLLIMLIGALLTAVNFTSAPKRQPETLPQ |
| Ga0306921_110786111 | 3300031912 | Soil | VAGCDDAAGTDMKIYLLMMLIGILLAAVHFTSAPKRPSNSLQQ |
| Ga0308174_100903332 | 3300031939 | Soil | VWGCDDAAEKDMKIYLLMVLFGILLTAIHFTSAQERGSKSLQQ |
| Ga0306926_123322022 | 3300031954 | Soil | MDTAETDMKIYLLMALIGTLLTAVHFTSAPEQRSKTLPQ |
| Ga0307470_111147462 | 3300032174 | Hardwood Forest Soil | GCNGAAESDMKIYLLIMLIGSLLAATHFTSAPKRQSETLPQ |
| Ga0307472_1006933002 | 3300032205 | Hardwood Forest Soil | VERRLHCRGSCNGAAESDMKIYLLIMLIGTLLAAVHFTSAAEQPSETLPQ |
| Ga0306920_1017348312 | 3300032261 | Soil | AGTDMKIYLLMMLIGILLAAVHFTSAPKRPSNSLQQ |
| Ga0310914_106526941 | 3300033289 | Soil | EQAMKIYLLLTLIGTLLTAVHFTSAPKQNSKTLPQ |
| Ga0326727_100803874 | 3300033405 | Peat Soil | LGCQQQRASEKDMKIYLLMMLIGALLTAVNFNAAPKPGSKTISQ |
| Ga0310811_110704031 | 3300033475 | Soil | SCNGAAESDMKIYLLIMLIGTLLAAVHFTSASEKASETLPQ |
| Ga0370489_0104929_176_310 | 3300034127 | Untreated Peat Soil | MGIGCNRAAESNMKIYLLILLIGALLTAVHFTSAPEQRSKTMPQ |
| Ga0370485_0157487_421_549 | 3300034358 | Untreated Peat Soil | MGCNGAAESIMKIYLLMTLIGAILTAVHFTSAPEQRSKTLSQ |
| ⦗Top⦘ |