3300010050: Microbial community associated with xenic strain of Nostoc sp. EX-5-1

Overview

Basic Information

• IMG/M Taxon OID: 3300010050
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0121366 | Gp0153974 | Ga0133945
• Sample Name: Microbial community associated with xenic strain of Nostoc sp. EX-5-1
• Sequencing Status: Permanent Draft
• Sequencing Center: Oregon State University
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 138932135
• Sequencing Scaffolds: 3
• Novel Protein Genes: 3
• Associated Families: 3

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Microbial Community Associated With Xenic Strain Of Nostoc Sp. Ex-5-1
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Xenic Strain → Microbial Community Associated With Xenic Strain Of Nostoc Sp. Ex-5-1

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): Unclassified
• Earth Microbiome Project Ontology (EMPO): na → na → na

Location Information

• Location: unknown
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014281	Metagenome / Metatranscriptome	264	Y
F014635	Metagenome / Metatranscriptome	261	Y
F062002	Metagenome / Metatranscriptome	131	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0133945_100004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1221605
Ga0133945_117856	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	621
Ga0133945_117970	Not Available	619

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0133945_100004	Ga0133945_100004412	F062002	MSAQEFHRATKRGAVDARPGAALILGGILLLTRP*
Ga0133945_117856	Ga0133945_1178561	F014281	NGAAESVMKIYLLIMLIGTLLAATHFTSAPKRQSETLPQ*
Ga0133945_117970	Ga0133945_1179701	F014635	MFWIGLVGFAACIAVGVAALLVHDRRQRAAFIAGLSSAERERLSGFEKVSGDWHQYRDLLLHH*