3300010207: Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FC X16C

Overview

Basic Information

• IMG/M Taxon OID: 3300010207
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0120452 | Gp0154463 | Ga0136445
• Sample Name: Littoral zone phototrophic microbial communities from Lake Waban, Wellesley, MA - FC X16C
• Sequencing Status: Permanent Draft
• Sequencing Center: Marine Biological Laboratory
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 65435588
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Phototrophic Microbial Communities
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Freshwater → Lake → Sediment → Littoral → Phototrophic Microbial Communities

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): freshwater lake biome → freshwater littoral zone → lake sediment
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Lake Waban, Wellesley MA
• Coordinates
  • Lat. (^o): 42.2876
  • Long. (^o): -71.30117
  • Alt. (m): N/A
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014281	Metagenome / Metatranscriptome	264	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0136445_100178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	33112

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0136445_100178	Ga0136445_10017816	F014281	LQSTIDIGIGCNGAAESKMKIYLLMTLIGAILTAVHLTTVPERKSETLPQ*