| Basic Information | |
|---|---|
| Family ID | F012882 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 276 |
| Average Sequence Length | 43 residues |
| Representative Sequence | TETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Number of Associated Samples | 214 |
| Number of Associated Scaffolds | 276 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.72 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 85.51 % |
| Associated GOLD sequencing projects | 197 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (64.855 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (7.246 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.420 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.942 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.23% β-sheet: 23.94% Coil/Unstructured: 71.83% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 276 Family Scaffolds |
|---|---|---|
| PF10162 | G8 | 13.41 |
| PF08450 | SGL | 5.07 |
| PF12543 | DUF3738 | 2.17 |
| PF07995 | GSDH | 1.45 |
| PF00072 | Response_reg | 1.09 |
| PF00909 | Ammonium_transp | 1.09 |
| PF12796 | Ank_2 | 1.09 |
| PF03992 | ABM | 1.09 |
| PF00239 | Resolvase | 1.09 |
| PF01814 | Hemerythrin | 1.09 |
| PF00753 | Lactamase_B | 0.72 |
| PF13817 | DDE_Tnp_IS66_C | 0.72 |
| PF13618 | Gluconate_2-dh3 | 0.72 |
| PF14261 | DUF4351 | 0.72 |
| PF00593 | TonB_dep_Rec | 0.72 |
| PF13620 | CarboxypepD_reg | 0.72 |
| PF13637 | Ank_4 | 0.72 |
| PF13432 | TPR_16 | 0.72 |
| PF09957 | VapB_antitoxin | 0.72 |
| PF01850 | PIN | 0.72 |
| PF05163 | DinB | 0.36 |
| PF02452 | PemK_toxin | 0.36 |
| PF10137 | TIR-like | 0.36 |
| PF00268 | Ribonuc_red_sm | 0.36 |
| PF02749 | QRPTase_N | 0.36 |
| PF13414 | TPR_11 | 0.36 |
| PF00144 | Beta-lactamase | 0.36 |
| PF00589 | Phage_integrase | 0.36 |
| PF13377 | Peripla_BP_3 | 0.36 |
| PF04072 | LCM | 0.36 |
| PF00561 | Abhydrolase_1 | 0.36 |
| PF02954 | HTH_8 | 0.36 |
| PF00990 | GGDEF | 0.36 |
| PF14534 | DUF4440 | 0.36 |
| PF12740 | Chlorophyllase2 | 0.36 |
| PF00437 | T2SSE | 0.36 |
| PF06452 | CBM9_1 | 0.36 |
| PF13188 | PAS_8 | 0.36 |
| PF00171 | Aldedh | 0.36 |
| PF13442 | Cytochrome_CBB3 | 0.36 |
| PF00782 | DSPc | 0.36 |
| PF04397 | LytTR | 0.36 |
| PF07669 | Eco57I | 0.36 |
| PF12680 | SnoaL_2 | 0.36 |
| PF02211 | NHase_beta | 0.36 |
| PF00891 | Methyltransf_2 | 0.36 |
| PF00196 | GerE | 0.36 |
| PF00873 | ACR_tran | 0.36 |
| PF11746 | DUF3303 | 0.36 |
| PF08028 | Acyl-CoA_dh_2 | 0.36 |
| PF04851 | ResIII | 0.36 |
| PF03403 | PAF-AH_p_II | 0.36 |
| PF13857 | Ank_5 | 0.36 |
| PF13474 | SnoaL_3 | 0.36 |
| PF00583 | Acetyltransf_1 | 0.36 |
| PF09098 | Dehyd-heme_bind | 0.36 |
| PF03551 | PadR | 0.36 |
| PF00282 | Pyridoxal_deC | 0.36 |
| PF05729 | NACHT | 0.36 |
| PF05721 | PhyH | 0.36 |
| PF04542 | Sigma70_r2 | 0.36 |
| PF03050 | DDE_Tnp_IS66 | 0.36 |
| PF00080 | Sod_Cu | 0.36 |
| PF14552 | Tautomerase_2 | 0.36 |
| PF02371 | Transposase_20 | 0.36 |
| PF00230 | MIP | 0.36 |
| COG ID | Name | Functional Category | % Frequency in 276 Family Scaffolds |
|---|---|---|---|
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 5.07 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 5.07 |
| COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 1.45 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 1.09 |
| COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 1.09 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 1.09 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.36 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.36 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.36 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 0.36 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.36 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.36 |
| COG3436 | Transposase | Mobilome: prophages, transposons [X] | 0.36 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.36 |
| COG4188 | Predicted dienelactone hydrolase | General function prediction only [R] | 0.36 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.36 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.36 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.36 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.36 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.36 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.36 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.36 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.36 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.36 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.36 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.36 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.36 |
| COG0580 | Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family) | Carbohydrate transport and metabolism [G] | 0.36 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.36 |
| COG0208 | Ribonucleotide reductase beta subunit, ferritin-like domain | Nucleotide transport and metabolism [F] | 0.36 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.36 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.36 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.36 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.22 % |
| Unclassified | root | N/A | 34.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000890|JGI11643J12802_11376643 | Not Available | 897 | Open in IMG/M |
| 3300000891|JGI10214J12806_10488431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 696 | Open in IMG/M |
| 3300002730|zc4day99_1491023 | Not Available | 536 | Open in IMG/M |
| 3300003647|metazooDRAFT_1402029 | Not Available | 503 | Open in IMG/M |
| 3300004081|Ga0063454_101900510 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300004153|Ga0063455_101099261 | Not Available | 587 | Open in IMG/M |
| 3300005061|Ga0070921_1369690 | Not Available | 602 | Open in IMG/M |
| 3300005218|Ga0068996_10160619 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005290|Ga0065712_10098969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2104 | Open in IMG/M |
| 3300005295|Ga0065707_10854618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
| 3300005329|Ga0070683_100021668 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5737 | Open in IMG/M |
| 3300005329|Ga0070683_100307348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1508 | Open in IMG/M |
| 3300005331|Ga0070670_101666870 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005332|Ga0066388_102596626 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300005333|Ga0070677_10184189 | Not Available | 997 | Open in IMG/M |
| 3300005338|Ga0068868_100055359 | All Organisms → cellular organisms → Bacteria | 3129 | Open in IMG/M |
| 3300005338|Ga0068868_100257808 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1470 | Open in IMG/M |
| 3300005340|Ga0070689_100114263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2151 | Open in IMG/M |
| 3300005341|Ga0070691_11051403 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005343|Ga0070687_100778508 | Not Available | 676 | Open in IMG/M |
| 3300005355|Ga0070671_100453394 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300005438|Ga0070701_11383265 | Not Available | 505 | Open in IMG/M |
| 3300005445|Ga0070708_101399113 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005457|Ga0070662_101912188 | Not Available | 513 | Open in IMG/M |
| 3300005459|Ga0068867_101659321 | Not Available | 598 | Open in IMG/M |
| 3300005466|Ga0070685_10005912 | All Organisms → cellular organisms → Bacteria | 6227 | Open in IMG/M |
| 3300005466|Ga0070685_10677900 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005466|Ga0070685_10697962 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005526|Ga0073909_10293542 | Not Available | 736 | Open in IMG/M |
| 3300005533|Ga0070734_10453997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 730 | Open in IMG/M |
| 3300005533|Ga0070734_10573556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
| 3300005538|Ga0070731_10254564 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300005543|Ga0070672_100177181 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300005561|Ga0066699_10486553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300005563|Ga0068855_101431165 | Not Available | 711 | Open in IMG/M |
| 3300005564|Ga0070664_100236549 | Not Available | 1638 | Open in IMG/M |
| 3300005576|Ga0066708_10350855 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
| 3300005591|Ga0070761_10838398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 579 | Open in IMG/M |
| 3300005607|Ga0070740_10123352 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300005617|Ga0068859_100469204 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300005617|Ga0068859_100929999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 953 | Open in IMG/M |
| 3300005617|Ga0068859_100978931 | Not Available | 928 | Open in IMG/M |
| 3300005618|Ga0068864_100035477 | All Organisms → cellular organisms → Bacteria | 4246 | Open in IMG/M |
| 3300005618|Ga0068864_100175079 | Not Available | 1958 | Open in IMG/M |
| 3300005713|Ga0066905_101709349 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005764|Ga0066903_100769786 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1714 | Open in IMG/M |
| 3300005764|Ga0066903_101676716 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1209 | Open in IMG/M |
| 3300005764|Ga0066903_102916351 | Not Available | 927 | Open in IMG/M |
| 3300005764|Ga0066903_106450451 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300005830|Ga0074473_10226474 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1869 | Open in IMG/M |
| 3300005841|Ga0068863_101257255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella flava | 747 | Open in IMG/M |
| 3300005844|Ga0068862_100342639 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300005844|Ga0068862_101303420 | Not Available | 727 | Open in IMG/M |
| 3300005921|Ga0070766_11001960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. BCC1884 | 574 | Open in IMG/M |
| 3300005986|Ga0075152_10354315 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300006162|Ga0075030_101430088 | Not Available | 542 | Open in IMG/M |
| 3300006237|Ga0097621_100419764 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 1200 | Open in IMG/M |
| 3300006237|Ga0097621_102096483 | Not Available | 541 | Open in IMG/M |
| 3300006358|Ga0068871_101333084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 675 | Open in IMG/M |
| 3300006804|Ga0079221_11390398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300006844|Ga0075428_100044096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4902 | Open in IMG/M |
| 3300006852|Ga0075433_10268417 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1512 | Open in IMG/M |
| 3300006871|Ga0075434_100822864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
| 3300006880|Ga0075429_101993788 | Not Available | 503 | Open in IMG/M |
| 3300006881|Ga0068865_100725423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 851 | Open in IMG/M |
| 3300006894|Ga0079215_11206990 | Not Available | 576 | Open in IMG/M |
| 3300006903|Ga0075426_10824043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 698 | Open in IMG/M |
| 3300006954|Ga0079219_10753976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 754 | Open in IMG/M |
| 3300009092|Ga0105250_10313331 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300009093|Ga0105240_10001076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 48242 | Open in IMG/M |
| 3300009094|Ga0111539_10740356 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300009098|Ga0105245_11746773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 675 | Open in IMG/M |
| 3300009098|Ga0105245_11801880 | Not Available | 665 | Open in IMG/M |
| 3300009101|Ga0105247_11614031 | Not Available | 533 | Open in IMG/M |
| 3300009148|Ga0105243_10348338 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300009156|Ga0111538_10035265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 6473 | Open in IMG/M |
| 3300009156|Ga0111538_10075131 | All Organisms → cellular organisms → Bacteria | 4300 | Open in IMG/M |
| 3300009156|Ga0111538_11670051 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300009156|Ga0111538_12378436 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009156|Ga0111538_12803265 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300009162|Ga0075423_13135685 | Not Available | 506 | Open in IMG/M |
| 3300009174|Ga0105241_12428114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 524 | Open in IMG/M |
| 3300009177|Ga0105248_10078102 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3722 | Open in IMG/M |
| 3300009177|Ga0105248_10147019 | All Organisms → cellular organisms → Bacteria | 2659 | Open in IMG/M |
| 3300009177|Ga0105248_12302085 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300009177|Ga0105248_13251118 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 517 | Open in IMG/M |
| 3300009257|Ga0103869_10190325 | Not Available | 560 | Open in IMG/M |
| 3300009553|Ga0105249_10958744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 923 | Open in IMG/M |
| 3300009553|Ga0105249_11603093 | Not Available | 723 | Open in IMG/M |
| 3300009610|Ga0105340_1303777 | Not Available | 696 | Open in IMG/M |
| 3300009688|Ga0116176_10623418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300009700|Ga0116217_10775746 | Not Available | 591 | Open in IMG/M |
| 3300009813|Ga0105057_1089644 | Not Available | 556 | Open in IMG/M |
| 3300009948|Ga0131847_148958 | Not Available | 566 | Open in IMG/M |
| 3300009949|Ga0131846_112072 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1284 | Open in IMG/M |
| 3300010043|Ga0126380_11504750 | Not Available | 596 | Open in IMG/M |
| 3300010044|Ga0126310_10896616 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010046|Ga0126384_11341526 | Not Available | 665 | Open in IMG/M |
| 3300010047|Ga0126382_10086978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1975 | Open in IMG/M |
| 3300010047|Ga0126382_11346740 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010047|Ga0126382_11608655 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300010048|Ga0126373_13074852 | Not Available | 520 | Open in IMG/M |
| 3300010360|Ga0126372_10908911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 884 | Open in IMG/M |
| 3300010360|Ga0126372_11422506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 727 | Open in IMG/M |
| 3300010360|Ga0126372_11776024 | Not Available | 659 | Open in IMG/M |
| 3300010361|Ga0126378_10821158 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 1038 | Open in IMG/M |
| 3300010361|Ga0126378_12356937 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300010371|Ga0134125_13054142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 507 | Open in IMG/M |
| 3300010375|Ga0105239_10894774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1019 | Open in IMG/M |
| 3300010376|Ga0126381_101483108 | Not Available | 980 | Open in IMG/M |
| 3300010376|Ga0126381_102386993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 759 | Open in IMG/M |
| 3300010376|Ga0126381_104026732 | Not Available | 572 | Open in IMG/M |
| 3300010397|Ga0134124_11407960 | Not Available | 723 | Open in IMG/M |
| 3300010398|Ga0126383_10559122 | Not Available | 1210 | Open in IMG/M |
| 3300010398|Ga0126383_11412238 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300010398|Ga0126383_12907318 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 559 | Open in IMG/M |
| 3300010400|Ga0134122_12725224 | Not Available | 546 | Open in IMG/M |
| 3300010403|Ga0134123_12765942 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
| 3300011421|Ga0137462_1085548 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300011429|Ga0137455_1047252 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
| 3300011435|Ga0137426_1196269 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300012200|Ga0137382_10841274 | Not Available | 661 | Open in IMG/M |
| 3300012469|Ga0150984_112525494 | Not Available | 627 | Open in IMG/M |
| 3300012474|Ga0157356_1015552 | Not Available | 574 | Open in IMG/M |
| 3300012505|Ga0157339_1064214 | Not Available | 516 | Open in IMG/M |
| 3300012892|Ga0157294_10033694 | Not Available | 1085 | Open in IMG/M |
| 3300012895|Ga0157309_10046214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter | 1066 | Open in IMG/M |
| 3300012904|Ga0157282_10220870 | Not Available | 624 | Open in IMG/M |
| 3300012904|Ga0157282_10269692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 585 | Open in IMG/M |
| 3300012909|Ga0157290_10056854 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300012909|Ga0157290_10289308 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300012917|Ga0137395_11289635 | Not Available | 505 | Open in IMG/M |
| 3300012960|Ga0164301_11225660 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300012971|Ga0126369_12323013 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012982|Ga0168317_1018166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 2101 | Open in IMG/M |
| 3300012982|Ga0168317_1098301 | Not Available | 643 | Open in IMG/M |
| 3300012984|Ga0164309_11157576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076 | 646 | Open in IMG/M |
| 3300012989|Ga0164305_10353544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1108 | Open in IMG/M |
| 3300012989|Ga0164305_12213196 | Not Available | 506 | Open in IMG/M |
| 3300013297|Ga0157378_10038129 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4258 | Open in IMG/M |
| 3300013297|Ga0157378_11696385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 679 | Open in IMG/M |
| 3300013306|Ga0163162_11439542 | Not Available | 784 | Open in IMG/M |
| 3300013307|Ga0157372_11600214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 750 | Open in IMG/M |
| 3300013307|Ga0157372_13355921 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300013308|Ga0157375_10033675 | All Organisms → cellular organisms → Bacteria | 4872 | Open in IMG/M |
| 3300013308|Ga0157375_10129015 | All Organisms → cellular organisms → Bacteria | 2647 | Open in IMG/M |
| 3300014303|Ga0075358_1148045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 507 | Open in IMG/M |
| 3300014745|Ga0157377_11371591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300014877|Ga0180074_1098680 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
| 3300014969|Ga0157376_10074149 | All Organisms → cellular organisms → Bacteria | 2900 | Open in IMG/M |
| 3300014969|Ga0157376_10706644 | Not Available | 1014 | Open in IMG/M |
| 3300015372|Ga0132256_102564773 | Not Available | 611 | Open in IMG/M |
| 3300015373|Ga0132257_101758966 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300015373|Ga0132257_101998221 | Not Available | 748 | Open in IMG/M |
| 3300016341|Ga0182035_11625020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 583 | Open in IMG/M |
| 3300017792|Ga0163161_10748885 | Not Available | 817 | Open in IMG/M |
| 3300017792|Ga0163161_11021229 | Not Available | 707 | Open in IMG/M |
| 3300017792|Ga0163161_11848659 | Not Available | 537 | Open in IMG/M |
| 3300017822|Ga0187802_10167714 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300017959|Ga0187779_11151423 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300017966|Ga0187776_10152520 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
| 3300017966|Ga0187776_11512815 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300017975|Ga0187782_10512460 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300018055|Ga0184616_10333156 | Not Available | 573 | Open in IMG/M |
| 3300018060|Ga0187765_10426135 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300018083|Ga0184628_10021235 | All Organisms → cellular organisms → Bacteria | 3198 | Open in IMG/M |
| 3300018090|Ga0187770_11035314 | Not Available | 661 | Open in IMG/M |
| 3300018476|Ga0190274_10091097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2388 | Open in IMG/M |
| 3300018476|Ga0190274_10712145 | Not Available | 1050 | Open in IMG/M |
| 3300018481|Ga0190271_12889557 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300019361|Ga0173482_10594910 | Not Available | 555 | Open in IMG/M |
| 3300021168|Ga0210406_10303365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1298 | Open in IMG/M |
| 3300021180|Ga0210396_10727137 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300021401|Ga0210393_11156670 | Not Available | 624 | Open in IMG/M |
| 3300021402|Ga0210385_10048777 | All Organisms → cellular organisms → Bacteria | 2818 | Open in IMG/M |
| 3300021406|Ga0210386_10433287 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300021477|Ga0210398_10932597 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300021477|Ga0210398_11355595 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021559|Ga0210409_10576495 | Not Available | 992 | Open in IMG/M |
| 3300022899|Ga0247795_1067485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300022915|Ga0247790_10005505 | All Organisms → cellular organisms → Bacteria | 2467 | Open in IMG/M |
| 3300024566|Ga0256309_1008838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2759 | Open in IMG/M |
| 3300025160|Ga0209109_10059411 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
| 3300025324|Ga0209640_10022736 | All Organisms → cellular organisms → Bacteria | 5471 | Open in IMG/M |
| 3300025913|Ga0207695_10248333 | Not Available | 1679 | Open in IMG/M |
| 3300025913|Ga0207695_10702139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 892 | Open in IMG/M |
| 3300025914|Ga0207671_10217813 | Not Available | 1495 | Open in IMG/M |
| 3300025918|Ga0207662_10053482 | All Organisms → cellular organisms → Bacteria | 2405 | Open in IMG/M |
| 3300025918|Ga0207662_10391103 | Not Available | 941 | Open in IMG/M |
| 3300025918|Ga0207662_10731439 | Not Available | 695 | Open in IMG/M |
| 3300025918|Ga0207662_10850337 | Not Available | 645 | Open in IMG/M |
| 3300025925|Ga0207650_10527160 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300025926|Ga0207659_10621063 | Not Available | 922 | Open in IMG/M |
| 3300025932|Ga0207690_10413853 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300025934|Ga0207686_10418039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 1025 | Open in IMG/M |
| 3300025938|Ga0207704_10026270 | All Organisms → cellular organisms → Bacteria | 3192 | Open in IMG/M |
| 3300025940|Ga0207691_10082087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2896 | Open in IMG/M |
| 3300025940|Ga0207691_10801480 | Not Available | 792 | Open in IMG/M |
| 3300025942|Ga0207689_10234958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1515 | Open in IMG/M |
| 3300025944|Ga0207661_11673303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 581 | Open in IMG/M |
| 3300025945|Ga0207679_10129772 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 2020 | Open in IMG/M |
| 3300025949|Ga0207667_10976989 | Not Available | 835 | Open in IMG/M |
| 3300025960|Ga0207651_11382302 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300025960|Ga0207651_11940852 | Not Available | 529 | Open in IMG/M |
| 3300025986|Ga0207658_11807124 | Not Available | 557 | Open in IMG/M |
| 3300026023|Ga0207677_10619282 | Not Available | 952 | Open in IMG/M |
| 3300026089|Ga0207648_10330240 | Not Available | 1372 | Open in IMG/M |
| 3300026089|Ga0207648_10806194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermatophilaceae → unclassified Dermatophilaceae → Dermatophilaceae bacterium | 874 | Open in IMG/M |
| 3300026095|Ga0207676_12609286 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300026121|Ga0207683_10238033 | Not Available | 1660 | Open in IMG/M |
| 3300026121|Ga0207683_11070214 | Not Available | 748 | Open in IMG/M |
| 3300027535|Ga0209734_1052825 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300027664|Ga0207873_1022552 | All Organisms → cellular organisms → Bacteria | 2715 | Open in IMG/M |
| 3300027664|Ga0207873_1071423 | Not Available | 1186 | Open in IMG/M |
| 3300027725|Ga0209178_1243059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300027794|Ga0209480_10295628 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300027855|Ga0209693_10163709 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300027855|Ga0209693_10165021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1093 | Open in IMG/M |
| 3300027869|Ga0209579_10144011 | Not Available | 1269 | Open in IMG/M |
| 3300027874|Ga0209465_10034602 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2388 | Open in IMG/M |
| 3300027882|Ga0209590_10272032 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300027884|Ga0209275_10197298 | Not Available | 1087 | Open in IMG/M |
| 3300027886|Ga0209486_10876079 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300027908|Ga0209006_10037854 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4358 | Open in IMG/M |
| 3300028381|Ga0268264_10754660 | Not Available | 969 | Open in IMG/M |
| 3300028592|Ga0247822_10908024 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 723 | Open in IMG/M |
| 3300028710|Ga0307322_10185899 | Not Available | 563 | Open in IMG/M |
| 3300028808|Ga0302228_10457620 | Not Available | 564 | Open in IMG/M |
| 3300028812|Ga0247825_10033022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3421 | Open in IMG/M |
| 3300029951|Ga0311371_11866220 | Not Available | 645 | Open in IMG/M |
| 3300029990|Ga0311336_10784168 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300030007|Ga0311338_11766599 | Not Available | 558 | Open in IMG/M |
| 3300030618|Ga0311354_10516692 | Not Available | 1177 | Open in IMG/M |
| 3300031028|Ga0302180_10142406 | Not Available | 1336 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10129357 | Not Available | 688 | Open in IMG/M |
| 3300031198|Ga0307500_10221791 | Not Available | 573 | Open in IMG/M |
| 3300031231|Ga0170824_110282695 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031234|Ga0302325_10222852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfosarcina → Desulfosarcina alkanivorans | 3198 | Open in IMG/M |
| 3300031234|Ga0302325_10385099 | All Organisms → cellular organisms → Bacteria | 2197 | Open in IMG/M |
| 3300031236|Ga0302324_101004717 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300031236|Ga0302324_101380316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300031446|Ga0170820_17696736 | Not Available | 543 | Open in IMG/M |
| 3300031521|Ga0311364_11893262 | Not Available | 586 | Open in IMG/M |
| 3300031525|Ga0302326_10080307 | All Organisms → cellular organisms → Bacteria | 5970 | Open in IMG/M |
| 3300031538|Ga0310888_10761148 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031562|Ga0310886_10018825 | Not Available | 2721 | Open in IMG/M |
| 3300031708|Ga0310686_117358838 | Not Available | 655 | Open in IMG/M |
| 3300031740|Ga0307468_100656820 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300031753|Ga0307477_10593518 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300031858|Ga0310892_10005591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. SG61-1L | 4755 | Open in IMG/M |
| 3300031858|Ga0310892_10419907 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300031910|Ga0306923_11694654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 653 | Open in IMG/M |
| 3300031938|Ga0308175_100571472 | All Organisms → cellular organisms → Bacteria | 1213 | Open in IMG/M |
| 3300031938|Ga0308175_100961794 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300031944|Ga0310884_10281565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300032000|Ga0310903_10178372 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300032001|Ga0306922_11431162 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 694 | Open in IMG/M |
| 3300032012|Ga0310902_10985102 | Not Available | 585 | Open in IMG/M |
| 3300032017|Ga0310899_10668246 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032064|Ga0318510_10221935 | Not Available | 770 | Open in IMG/M |
| 3300032075|Ga0310890_10035461 | All Organisms → cellular organisms → Bacteria | 2733 | Open in IMG/M |
| 3300032144|Ga0315910_10073775 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
| 3300032144|Ga0315910_11254053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 579 | Open in IMG/M |
| 3300032157|Ga0315912_10175700 | All Organisms → Viruses → Predicted Viral | 1679 | Open in IMG/M |
| 3300032160|Ga0311301_10553881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1680 | Open in IMG/M |
| 3300032174|Ga0307470_10628664 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300032770|Ga0335085_10659157 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1169 | Open in IMG/M |
| 3300032805|Ga0335078_10144561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3373 | Open in IMG/M |
| 3300032805|Ga0335078_11856026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → unclassified Acetobacteraceae → Acetobacteraceae bacterium | 652 | Open in IMG/M |
| 3300032828|Ga0335080_11357991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 708 | Open in IMG/M |
| 3300033158|Ga0335077_11564544 | Not Available | 629 | Open in IMG/M |
| 3300033289|Ga0310914_10291351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1471 | Open in IMG/M |
| 3300033289|Ga0310914_10434964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1187 | Open in IMG/M |
| 3300033487|Ga0316630_11441626 | Not Available | 619 | Open in IMG/M |
| 3300034151|Ga0364935_0079271 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 989 | Open in IMG/M |
| 3300034669|Ga0314794_052786 | Not Available | 772 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.25% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.07% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.99% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.62% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.62% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.26% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.26% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.90% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.54% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.54% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.17% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.17% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.17% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.17% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.17% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.81% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.81% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.81% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.81% |
| Compost | Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost | 1.81% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.45% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.09% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.09% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.09% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.72% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
| Weathered Mine Tailings | Environmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings | 0.72% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.72% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.72% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.72% |
| Feedstock Adapted Compost | Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost | 0.72% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.72% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.36% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.36% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.36% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.36% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.36% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.36% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.36% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.36% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.36% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.36% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.36% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.36% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.36% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.36% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.36% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300002730 | Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 day 99 | Engineered | Open in IMG/M |
| 3300003647 | Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 day 78 | Engineered | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005061 | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 30 soap2 | Engineered | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005986 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA | Engineered | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009610 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 | Environmental | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009948 | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 30 mira | Engineered | Open in IMG/M |
| 3300009949 | Compost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 15 mira | Engineered | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011435 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
| 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012982 | Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DCWfield | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014303 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D1 | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300024566 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027664 | Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes) | Engineered | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027794 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033487 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_A | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11643J12802_113766432 | 3300000890 | Soil | TSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| JGI10214J12806_104884311 | 3300000891 | Soil | TETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPSDTQTSITVRR* |
| zc4day99_14910231 | 3300002730 | Compost | ETSFYKAPDAVWVKLVIPTAPKGVGRDEFGPLDSQTSIVVRR* |
| metazooDRAFT_14020291 | 3300003647 | Compost | QDSLDALRKATETSYFKAPDAVWVKLVIPTAPKGVGRDEFGPLESQTSIVVRR* |
| Ga0063454_1019005101 | 3300004081 | Soil | TETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR* |
| Ga0063455_1010992611 | 3300004153 | Soil | YFKGPDAVWVKLVIPTAPKGVGIEQFGPSDTQTSITVRR* |
| Ga0070921_13696902 | 3300005061 | Compost | ALRKATETSFYKAPDAVWVKLVIPTAPKGVGRDEFGPLDSQTSIVVRR* |
| Ga0068996_101606192 | 3300005218 | Natural And Restored Wetlands | RKATETSYFKGPDAVWVKLVVPTAPKGIGRDQFGPLDTQASIVVSK* |
| Ga0065712_100989691 | 3300005290 | Miscanthus Rhizosphere | YFKGPDAVWVKLVIPTAPKGIGMDQFGPSDIQTSITVRR* |
| Ga0065707_108546183 | 3300005295 | Switchgrass Rhizosphere | TSYFKGPDAVWVKLVIPTAPKGVGRNQFGPLDTQTSITVSR* |
| Ga0070683_1000216681 | 3300005329 | Corn Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR* |
| Ga0070683_1003073481 | 3300005329 | Corn Rhizosphere | ETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPLDTQASITVSR* |
| Ga0070670_1016668701 | 3300005331 | Switchgrass Rhizosphere | LRKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVRR* |
| Ga0066388_1025966261 | 3300005332 | Tropical Forest Soil | DALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0070677_101841892 | 3300005333 | Miscanthus Rhizosphere | ALRNATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPSDTQTSIVVRR* |
| Ga0068868_1000553591 | 3300005338 | Miscanthus Rhizosphere | QDSIDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR* |
| Ga0068868_1002578082 | 3300005338 | Miscanthus Rhizosphere | TETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVSR* |
| Ga0070689_1001142636 | 3300005340 | Switchgrass Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGVGIDQFGPLDTQTSITVSR* |
| Ga0070691_110514031 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | ATETSYFKAPDAVWVKLVIPNAPKGIGIDQFGPLDTQTTITVRR* |
| Ga0070687_1007785081 | 3300005343 | Switchgrass Rhizosphere | VTAARLRKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPL |
| Ga0070671_1004533943 | 3300005355 | Switchgrass Rhizosphere | ETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVSR* |
| Ga0070701_113832651 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | ALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0070708_1013991132 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LRKATETSYFKGPDAVWVKLVVPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0070662_1019121881 | 3300005457 | Corn Rhizosphere | IDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR* |
| Ga0068867_1016593211 | 3300005459 | Miscanthus Rhizosphere | IDALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0070685_100059121 | 3300005466 | Switchgrass Rhizosphere | DALRKATETSYFKGPDAVWVKLVIATAPKGIGMDQFNSGTQASITVRR* |
| Ga0070685_106779001 | 3300005466 | Switchgrass Rhizosphere | ATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPTDTQTSITIRR* |
| Ga0070685_106979621 | 3300005466 | Switchgrass Rhizosphere | TETSYFKGPDAVWVKLVIPTAPKGVGIDQFGPLDTQTSITVSR* |
| Ga0073909_102935423 | 3300005526 | Surface Soil | KGPDAVWVKLVIPTAPKGVGRDQFGPLDTQASITVSR* |
| Ga0070734_104539972 | 3300005533 | Surface Soil | LRKATETSYFKGPDAVWVKLVIPTAPKGIGRDQFGPLDTQTSITVRR* |
| Ga0070734_105735562 | 3300005533 | Surface Soil | KGPDAVWVKLVIPTAPKGIGMDQFGPLDTQASITVRR* |
| Ga0070731_102545641 | 3300005538 | Surface Soil | DALRKATETSYFKGPDAVWVKLVIPIARKGVGRDQFGPSDTQTSITVSR* |
| Ga0070672_1001771811 | 3300005543 | Miscanthus Rhizosphere | LRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR* |
| Ga0066699_104865532 | 3300005561 | Soil | DALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0068855_1014311651 | 3300005563 | Corn Rhizosphere | ATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR* |
| Ga0070664_1002365492 | 3300005564 | Corn Rhizosphere | FKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVRR* |
| Ga0066708_103508553 | 3300005576 | Soil | DAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0070761_108383982 | 3300005591 | Soil | PDAVWVKLVIPTAPKGIGRDQFGPLDTQASITVSR* |
| Ga0070740_101233521 | 3300005607 | Surface Soil | PDAVWVKLVIPTAPKGIGRDQFGPLDTQASITVRR* |
| Ga0068859_1004692041 | 3300005617 | Switchgrass Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0068859_1009299991 | 3300005617 | Switchgrass Rhizosphere | DAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0068859_1009789311 | 3300005617 | Switchgrass Rhizosphere | SYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDIQTSITVRR* |
| Ga0068864_1000354777 | 3300005618 | Switchgrass Rhizosphere | KGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR* |
| Ga0068864_1001750791 | 3300005618 | Switchgrass Rhizosphere | RKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVSR* |
| Ga0066905_1017093492 | 3300005713 | Tropical Forest Soil | DALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR* |
| Ga0066903_1007697865 | 3300005764 | Tropical Forest Soil | KGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0066903_1016767161 | 3300005764 | Tropical Forest Soil | SYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0066903_1029163511 | 3300005764 | Tropical Forest Soil | DALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR* |
| Ga0066903_1064504512 | 3300005764 | Tropical Forest Soil | SYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR* |
| Ga0074473_102264743 | 3300005830 | Sediment (Intertidal) | PDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVRR* |
| Ga0068863_1012572551 | 3300005841 | Switchgrass Rhizosphere | PDAVWVKLVIPTAPKGVGRDQFGPLDNQTSITVSR* |
| Ga0068862_1003426391 | 3300005844 | Switchgrass Rhizosphere | KATETSYFKGPDAVWVKLVVPTAPKGVGRDQFGPLDTQTSIVVSR* |
| Ga0068862_1013034201 | 3300005844 | Switchgrass Rhizosphere | QDSIDALRKATETSYFKGPDAVWVKLVIPTAPTGIGMDQFGPSVTQTSITVRR* |
| Ga0070766_110019602 | 3300005921 | Soil | ATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0075152_103543152 | 3300005986 | Wastewater Effluent | ETSYFKGADAVWVKLVIPTAPNGVGRDQFGPLDTQTSITVSR* |
| Ga0075030_1014300882 | 3300006162 | Watersheds | YFKGPDAVWVKLVIPTAPKGIGMDQFGPLDTQASITVSR* |
| Ga0097621_1004197641 | 3300006237 | Miscanthus Rhizosphere | QDSIDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR* |
| Ga0097621_1020964831 | 3300006237 | Miscanthus Rhizosphere | IDALRKATETSYFKGPDAVWVKLVIPTAPNGIGMDQFGPSVTQTSITVRR* |
| Ga0068871_1013330841 | 3300006358 | Miscanthus Rhizosphere | LDALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSVTQTSITVRR* |
| Ga0079221_113903981 | 3300006804 | Agricultural Soil | KATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0075428_1000440961 | 3300006844 | Populus Rhizosphere | LRKATETSYFKGPDAVWVKLVIPTAPKGVGRNQFGPLDTQTSITVSR* |
| Ga0075433_102684171 | 3300006852 | Populus Rhizosphere | FKGPDAVWVKLVVPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0075434_1008228643 | 3300006871 | Populus Rhizosphere | RKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0075429_1019937881 | 3300006880 | Populus Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0068865_1007254232 | 3300006881 | Miscanthus Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSITQTCITVRR* |
| Ga0079215_112069902 | 3300006894 | Agricultural Soil | SYFKGPDAVWVKLVIPTAPKGVGRDQFGPSDTQTSIVVSR* |
| Ga0075426_108240431 | 3300006903 | Populus Rhizosphere | LDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR* |
| Ga0079219_107539761 | 3300006954 | Agricultural Soil | TETSYFKGPDTVWVKLVVPTAPKGIGMDQFGPLDTQTSITVRR* |
| Ga0105250_103133311 | 3300009092 | Switchgrass Rhizosphere | IDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMELFNSGTQASITVRR* |
| Ga0105240_100010761 | 3300009093 | Corn Rhizosphere | IDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0111539_107403563 | 3300009094 | Populus Rhizosphere | YFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0105245_117467731 | 3300009098 | Miscanthus Rhizosphere | DALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSITQTSITVRR* |
| Ga0105245_118018802 | 3300009098 | Miscanthus Rhizosphere | DALRKATETSYFKGPDAVWVKLVVPTAPKGIGIDQFGPSDTQTSITVRR* |
| Ga0105247_116140311 | 3300009101 | Switchgrass Rhizosphere | ATETSYFKGPDAVWVKLVIPTASQGIGMDQFGPSDTQTTITVRR* |
| Ga0105243_103483381 | 3300009148 | Miscanthus Rhizosphere | LRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR* |
| Ga0111538_100352651 | 3300009156 | Populus Rhizosphere | KGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0111538_100751315 | 3300009156 | Populus Rhizosphere | SYFKGPDAVWVKLVIPTAPKGIGMEQFNSGTQATIMVRR* |
| Ga0111538_116700511 | 3300009156 | Populus Rhizosphere | ATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0111538_123784361 | 3300009156 | Populus Rhizosphere | GPDAVWVKLVIPTAPNGVGRDQFGPLDTQASIVVSR* |
| Ga0111538_128032651 | 3300009156 | Populus Rhizosphere | ETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0075423_131356851 | 3300009162 | Populus Rhizosphere | QDSIDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMEQFNSGTQATITVRR* |
| Ga0105241_124281142 | 3300009174 | Corn Rhizosphere | DAVWVKLVVPTAPKGIGMDQFGPLDTQTSITVRR* |
| Ga0105248_100781025 | 3300009177 | Switchgrass Rhizosphere | RKATETSYFKGPDAVWVKLVIPTASKGIGMDQFGPSDTQTTITVRR* |
| Ga0105248_101470191 | 3300009177 | Switchgrass Rhizosphere | GPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR* |
| Ga0105248_123020852 | 3300009177 | Switchgrass Rhizosphere | ETSYFKAPDAVWVKLVIPTAPKGIGMDQFGPGDQTSITVKR* |
| Ga0105248_132511182 | 3300009177 | Switchgrass Rhizosphere | SYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0103869_101903252 | 3300009257 | River Water | ATETSYFKGADAVWVKLVIPTAPKGIGMDQFGPADTQASITVRR* |
| Ga0105249_109587441 | 3300009553 | Switchgrass Rhizosphere | GPDAVWVKLVLPTTPKGVGRDQFGPLDTQTSITVSR* |
| Ga0105249_116030932 | 3300009553 | Switchgrass Rhizosphere | PDAVWVKLVIPTAPKGVGIDQFGPLDTQTSIVVRR* |
| Ga0105340_13037771 | 3300009610 | Soil | ETSYFKGPDAVWVKLVIATAPKGIGMDQFNSGTQASITVRR* |
| Ga0116176_106234181 | 3300009688 | Anaerobic Digestor Sludge | PEAVWVKLVVPTAPKGIGRDQFGPGDTQTSITVSR* |
| Ga0116217_107757462 | 3300009700 | Peatlands Soil | ATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0105057_10896442 | 3300009813 | Groundwater Sand | ALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0131847_1489581 | 3300009948 | Compost | ALRKATETSFYKAPDAGCVKLVIPTAPKGVGRDEFGPLDSQTSIVVRR* |
| Ga0131846_1120721 | 3300009949 | Compost | AASSCKQQPSLDALRXATETSCFKSADAVWVKLVVTTAPKGVGRDEFGPLDTQASVTVSR |
| Ga0126380_115047501 | 3300010043 | Tropical Forest Soil | GAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0126310_108966161 | 3300010044 | Serpentine Soil | DTIDALRKATETSYFKGPDAVWVKLVIATAPKGIGMDQFNSGTQASITVRR* |
| Ga0126384_113415261 | 3300010046 | Tropical Forest Soil | KGPDAIWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR* |
| Ga0126382_100869781 | 3300010047 | Tropical Forest Soil | LDALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0126382_113467401 | 3300010047 | Tropical Forest Soil | TETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPQDTQASITVRR* |
| Ga0126382_116086551 | 3300010047 | Tropical Forest Soil | TSYFKGPDAVWVKLVIQTAPKGIGMDQFNSGTQASITVRR* |
| Ga0126373_130748522 | 3300010048 | Tropical Forest Soil | DAVWVKLVIPTAPKGIGMDQFGPSDTETSITVRR* |
| Ga0126372_109089111 | 3300010360 | Tropical Forest Soil | PDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR* |
| Ga0126372_114225062 | 3300010360 | Tropical Forest Soil | PDAVWVKLVIPTAPKGIGMDQFGPLDTQTSITVRR* |
| Ga0126372_117760242 | 3300010360 | Tropical Forest Soil | FKGPDAVWVKLVIPTAPKGIGMDQFGPLDTQTSITVRR* |
| Ga0126378_108211583 | 3300010361 | Tropical Forest Soil | TETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0126378_123569371 | 3300010361 | Tropical Forest Soil | KATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQASITVRR* |
| Ga0134125_130541421 | 3300010371 | Terrestrial Soil | KATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVRR* |
| Ga0105239_108947741 | 3300010375 | Corn Rhizosphere | DALRKATETSYFKGPDAVWVKLVVPTAPKGIGMDQFGPLDTQTSITVRR* |
| Ga0126381_1014831082 | 3300010376 | Tropical Forest Soil | PDAVWVKLVIPTAPKGIGMDQFGPSDTETSITVRR* |
| Ga0126381_1023869931 | 3300010376 | Tropical Forest Soil | TSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0126381_1040267321 | 3300010376 | Tropical Forest Soil | FKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0134124_114079601 | 3300010397 | Terrestrial Soil | TETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPQDTQASIVVRR* |
| Ga0126383_105591223 | 3300010398 | Tropical Forest Soil | FKGPDAVWVKLVIPTAPKGIGMDQFGPSDTENSITVRR* |
| Ga0126383_114122382 | 3300010398 | Tropical Forest Soil | FKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR* |
| Ga0126383_129073183 | 3300010398 | Tropical Forest Soil | SYFKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR* |
| Ga0134122_127252242 | 3300010400 | Terrestrial Soil | GRDAVWVKLVIPTDPKGVGRDQFGPLETQTSIVVSR* |
| Ga0134123_127659421 | 3300010403 | Terrestrial Soil | LRKATETSYFKGPDAVWVKLVVPTAPKGIGMDQFGPQDTQTSITVRR* |
| Ga0137462_10855481 | 3300011421 | Soil | ALRKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDAQTSIVVRR* |
| Ga0137455_10472521 | 3300011429 | Soil | ATETSYFKGPDAVWVKLVIATAPKGIGMDQFNSGTQASITVRR* |
| Ga0137426_11962691 | 3300011435 | Soil | KGPDALWVKLVIQTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0137382_108412741 | 3300012200 | Vadose Zone Soil | ATETSYLKGPEDVWVKLVIPTAPKAIGMDQFGPSVTQTSITVRR* |
| Ga0150984_1125254941 | 3300012469 | Avena Fatua Rhizosphere | YKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVSR* |
| Ga0157356_10155521 | 3300012474 | Unplanted Soil | SYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQATITVRR* |
| Ga0157339_10642141 | 3300012505 | Arabidopsis Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR* |
| Ga0157294_100336942 | 3300012892 | Soil | PDAVWVNLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0157309_100462142 | 3300012895 | Soil | TETSYFKAPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR* |
| Ga0157282_102208701 | 3300012904 | Soil | ALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR* |
| Ga0157282_102696921 | 3300012904 | Soil | TSYFKAADAVWVKLVIPTAPKGVGREQFGPLDTQTSITVSR* |
| Ga0157290_100568542 | 3300012909 | Soil | SYFKGPDAVWVKLVIPTAPNGVGRDQFGPLDTQASIVVSR* |
| Ga0157290_102893081 | 3300012909 | Soil | KGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR* |
| Ga0137395_112896351 | 3300012917 | Vadose Zone Soil | SIDALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSVTQTSITVRR* |
| Ga0164301_112256602 | 3300012960 | Soil | KGPDAVWVKLVIPTAPKGVGRDQFGPSDTQTSITVSR* |
| Ga0126369_123230131 | 3300012971 | Tropical Forest Soil | KGPDAVWVKLVIPTAPKGIGMDQFGPSDTQASITVRR* |
| Ga0168317_10181665 | 3300012982 | Weathered Mine Tailings | GPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0168317_10983011 | 3300012982 | Weathered Mine Tailings | GPDAVWVKLVIPTAPKGIGIDQFGPLDIQTSITVTR* |
| Ga0164309_111575761 | 3300012984 | Soil | TETSYFKGPDAVWVKLVIPTASKGIGMDQFLSGDQTSITVRR* |
| Ga0164305_103535441 | 3300012989 | Soil | YFKGPDAVWVKLVVPTAPKGIGMDQFGPLDTQTSITVRR* |
| Ga0164305_122131961 | 3300012989 | Soil | TSYFKGPDAVWVKLVIPTAPNGVGRDQFGPLDTQTSITVSR* |
| Ga0157378_100381292 | 3300013297 | Miscanthus Rhizosphere | YFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR* |
| Ga0157378_116963852 | 3300013297 | Miscanthus Rhizosphere | DALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPVDTQTSITVRR* |
| Ga0163162_114395421 | 3300013306 | Switchgrass Rhizosphere | FKGPDAVWVKLVIPTAPKGIGMDQFGPQDTQASIVVRR* |
| Ga0157372_116002142 | 3300013307 | Corn Rhizosphere | RKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0157372_133559212 | 3300013307 | Corn Rhizosphere | YFKGKDAVWVKLVIPTAPHGVGRDQFGPLDTETSIVVSR* |
| Ga0157375_100336751 | 3300013308 | Miscanthus Rhizosphere | LRKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVSR* |
| Ga0157375_101290154 | 3300013308 | Miscanthus Rhizosphere | RKATETSYFKGPDAVWVKLVIPTAPKGIGRDQFGPLDTQTSIVVRR* |
| Ga0075358_11480451 | 3300014303 | Natural And Restored Wetlands | DAVWVKLVVPTAPNGIGRDQFGPGDAQASITVSR* |
| Ga0157377_113715911 | 3300014745 | Miscanthus Rhizosphere | RKATETSYFKGPDAVWVKLVIPTAPQGVGRDQFGPLDTQASITVRR* |
| Ga0180074_10986802 | 3300014877 | Soil | GPDAVWVKLVIPTAPKGVGIDQFGPLDTQTSITVSR* |
| Ga0157376_100741495 | 3300014969 | Miscanthus Rhizosphere | ATETSYYKAPDAVWVKLVIATAPKGIGMDQFGPSDTQTSITVRR* |
| Ga0157376_107066441 | 3300014969 | Miscanthus Rhizosphere | GPDAVWVKLVIPTAPKGIGMDQFNSGIQASITVRR* |
| Ga0132256_1025647732 | 3300015372 | Arabidopsis Rhizosphere | DALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR* |
| Ga0132257_1017589661 | 3300015373 | Arabidopsis Rhizosphere | QDTIDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQATITVRR* |
| Ga0132257_1019982211 | 3300015373 | Arabidopsis Rhizosphere | ETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDSQTSITVSR* |
| Ga0182035_116250202 | 3300016341 | Soil | RKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0163161_107488851 | 3300017792 | Switchgrass Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPQDTQASIVVRR |
| Ga0163161_110212291 | 3300017792 | Switchgrass Rhizosphere | SYYKAPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0163161_118486591 | 3300017792 | Switchgrass Rhizosphere | RKATETSYYKGPDAVWVKLVIPTAPKGVGIDQFGPLDTETSITVSR |
| Ga0187802_101677142 | 3300017822 | Freshwater Sediment | LDALRKATETSYFKSPDAVWVKLVIPTAPKGIGMDQFGPSDTETSITVRR |
| Ga0187779_111514231 | 3300017959 | Tropical Peatland | IDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPQDTETSITVRR |
| Ga0187776_101525202 | 3300017966 | Tropical Peatland | ALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0187776_115128152 | 3300017966 | Tropical Peatland | ATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0187782_105124603 | 3300017975 | Tropical Peatland | FKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0184616_103331561 | 3300018055 | Groundwater Sediment | ATETSYFKAPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0187765_104261351 | 3300018060 | Tropical Peatland | ALRKATETSYFKGPDAVWVKLVIPAAPKGIGMDQFGPSDTQTSITVRR |
| Ga0184628_100212355 | 3300018083 | Groundwater Sediment | SYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR |
| Ga0187770_110353142 | 3300018090 | Tropical Peatland | SYFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR |
| Ga0190274_100910974 | 3300018476 | Soil | LRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR |
| Ga0190274_107121451 | 3300018476 | Soil | KGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR |
| Ga0190271_128895571 | 3300018481 | Soil | FKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQASITVRR |
| Ga0173482_105949101 | 3300019361 | Soil | ATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVSR |
| Ga0210406_103033651 | 3300021168 | Soil | ALRKAAETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPLDTQTSITVRR |
| Ga0210396_107271372 | 3300021180 | Soil | IDALRKATETSYFKAPDAVWVKLVIPTAPQGIGRDQFGPLDIETSITVRR |
| Ga0210393_111566701 | 3300021401 | Soil | KGPDAVWVKLVIPTAPKGIGMDQFGPLDTQASITVSR |
| Ga0210385_100487773 | 3300021402 | Soil | SYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQASITVRR |
| Ga0210386_104332871 | 3300021406 | Soil | KATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQASITVRR |
| Ga0210398_109325972 | 3300021477 | Soil | ETSYFKGPDAVWVKLVIPTAPKGIGRDQFGPLDTLASITVSR |
| Ga0210398_113555951 | 3300021477 | Soil | YFKCPDAVWVKLVIPTAPKGIGMDQFGPSDTQASITVRR |
| Ga0210409_105764951 | 3300021559 | Soil | LRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0247795_10674851 | 3300022899 | Soil | ETSYFKAPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0247790_100055051 | 3300022915 | Soil | GPDAVWVKLVIPTAPKGVGRDQFGPLDTQASITVSR |
| Ga0256309_10088381 | 3300024566 | Freshwater | ETSYFKGTDAVWVKLVIPSAPKGMGRDEFVPAGTQASITVSR |
| Ga0209109_100594114 | 3300025160 | Soil | FKGPDAVWVKLVIPTAPKGVGIDQFGPLDTQTSITVRR |
| Ga0209640_100227361 | 3300025324 | Soil | IDALRKATETSYLKGPDAVWVKLVIPTAPKGVGIDQFGPLDTQTSITVRR |
| Ga0207695_102483331 | 3300025913 | Corn Rhizosphere | IDALRRATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0207695_107021392 | 3300025913 | Corn Rhizosphere | TETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0207671_102178131 | 3300025914 | Corn Rhizosphere | ETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0207662_100534821 | 3300025918 | Switchgrass Rhizosphere | KGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVSR |
| Ga0207662_103911031 | 3300025918 | Switchgrass Rhizosphere | RKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPQDTQTSIVVRR |
| Ga0207662_107314392 | 3300025918 | Switchgrass Rhizosphere | VTAARLRKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIV |
| Ga0207662_108503372 | 3300025918 | Switchgrass Rhizosphere | RKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR |
| Ga0207650_105271602 | 3300025925 | Switchgrass Rhizosphere | ATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPTDTQTSITVRR |
| Ga0207659_106210631 | 3300025926 | Miscanthus Rhizosphere | KGPDAVWVKLVIPTAPKGVGRDQFGPSDTQTSIVVRR |
| Ga0207690_104138532 | 3300025932 | Corn Rhizosphere | FKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR |
| Ga0207686_104180391 | 3300025934 | Miscanthus Rhizosphere | KGPDAVWVKLVIPTASKGIGMDQFLSGDQTSITVRR |
| Ga0207704_100262703 | 3300025938 | Miscanthus Rhizosphere | PDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR |
| Ga0207691_100820875 | 3300025940 | Miscanthus Rhizosphere | QDSIDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR |
| Ga0207691_108014801 | 3300025940 | Miscanthus Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVSR |
| Ga0207689_102349583 | 3300025942 | Miscanthus Rhizosphere | ATETSYFKGPDAVWVKLVVPTAPKGVGRDQFGPLDTQTSIVVSR |
| Ga0207661_116733031 | 3300025944 | Corn Rhizosphere | DALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0207679_101297723 | 3300025945 | Corn Rhizosphere | ATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVRR |
| Ga0207667_109769892 | 3300025949 | Corn Rhizosphere | YFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR |
| Ga0207651_113823022 | 3300025960 | Switchgrass Rhizosphere | ETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0207651_119408521 | 3300025960 | Switchgrass Rhizosphere | SYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0207658_118071241 | 3300025986 | Switchgrass Rhizosphere | RKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPQDTQASIVVRR |
| Ga0207677_106192821 | 3300026023 | Miscanthus Rhizosphere | YFKGRDAVWVKLVIPTDPKGVGRDQFGPLETQTSIVVSR |
| Ga0207648_103302402 | 3300026089 | Miscanthus Rhizosphere | TETSYFKGPDAVWVKLVIPTAPNGVGRDEFGPLDTQASITVRR |
| Ga0207648_108061941 | 3300026089 | Miscanthus Rhizosphere | YYKAPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0207676_126092862 | 3300026095 | Switchgrass Rhizosphere | LRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0207683_102380332 | 3300026121 | Miscanthus Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSIVVRR |
| Ga0207683_110702141 | 3300026121 | Miscanthus Rhizosphere | KATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0209734_10528251 | 3300027535 | Forest Soil | LDTLRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0207873_10225521 | 3300027664 | Feedstock Adapted Compost | ETSYFKAPDAVWVKLVIPTAPKGVGRDEFGPLESQTSIVVRR |
| Ga0207873_10714231 | 3300027664 | Feedstock Adapted Compost | ETSYFKAPDAVWVKLVIPTAPKGVGRDEFGPLDSQTSIVVRR |
| Ga0209178_12430591 | 3300027725 | Agricultural Soil | FKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQASITVRR |
| Ga0209480_102956281 | 3300027794 | Wastewater Effluent | KATETSYFKGADAVWVKLVIPTAPNGVGRDQFGPLDTQTSITVSR |
| Ga0209693_101637092 | 3300027855 | Soil | DALRKATETSYFKGPDAVWVKLVIPTAPQGIGMDQFGPSDTQTSITVRR |
| Ga0209693_101650212 | 3300027855 | Soil | DALRKATETSYFKGPDAVWVKLVIPTAPQGIGIDQFGPLDTQTSITVRR |
| Ga0209579_101440111 | 3300027869 | Surface Soil | DALRKATETSYFKGPDAVWVKLVIPIARKGVGRDQFGPSDTQTSITVSR |
| Ga0209465_100346021 | 3300027874 | Tropical Forest Soil | SYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0209590_102720322 | 3300027882 | Vadose Zone Soil | DSIDALRKATETSYFKGPDAVWVKLVIPTAPTGIGMDQFGPSVTQTSITVRR |
| Ga0209275_101972982 | 3300027884 | Soil | PDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0209486_108760792 | 3300027886 | Agricultural Soil | KATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQASITVRR |
| Ga0209006_100378541 | 3300027908 | Forest Soil | TETSYFKGPDAVWVKLVIPTAPQGIGMDQFGPSVTQTSITVRR |
| Ga0268264_107546602 | 3300028381 | Switchgrass Rhizosphere | ALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPQDTQASIVVRR |
| Ga0247822_109080242 | 3300028592 | Soil | LDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSVTVRR |
| Ga0307322_101858992 | 3300028710 | Soil | ETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR |
| Ga0302228_104576201 | 3300028808 | Palsa | SYFKGPDAVWVKLVIPTAPQGIGIDQFGPSDTQTSITVRR |
| Ga0247825_100330225 | 3300028812 | Soil | GPDAVWVKLVIPTAPKGVGRDQFGPLDTQASITVRR |
| Ga0311371_118662202 | 3300029951 | Palsa | IDALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0311336_107841682 | 3300029990 | Fen | ETSYFKAPDAVWVKLVIPTAPKGVGRDQFGPLDTETSIVVSR |
| Ga0311338_117665991 | 3300030007 | Palsa | DSIDALRNATETSYFKGPDAVWVKLVIPTAPQGIGMDQFGPSDTQTSITVRR |
| Ga0311354_105166921 | 3300030618 | Palsa | ALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0302180_101424061 | 3300031028 | Palsa | DSIDALRQATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPLDTQTSITVKR |
| (restricted) Ga0255310_101293571 | 3300031197 | Sandy Soil | GPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0307500_102217911 | 3300031198 | Soil | TETSYFKGPDAVWVKLVIPTAPKGVGIDQFGPSDTQTSIVVRR |
| Ga0170824_1102826952 | 3300031231 | Forest Soil | FKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0302325_102228521 | 3300031234 | Palsa | ATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPLDTQTSITVKR |
| Ga0302325_103850993 | 3300031234 | Palsa | ALRKATETSYFKGPDAVWVKLVIPTAPQGIGIDQFGPLDTQTSITVRR |
| Ga0302324_1010047171 | 3300031236 | Palsa | ALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR |
| Ga0302324_1013803162 | 3300031236 | Palsa | RKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0170820_176967361 | 3300031446 | Forest Soil | LRKATETSYFKGPDAVWVKLVIPTAPRGVGRDQFGPSDTQTSITVRR |
| Ga0311364_118932621 | 3300031521 | Fen | DSIDALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSVTQTSITVRR |
| Ga0302326_100803075 | 3300031525 | Palsa | KATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPLDTQTSITVRR |
| Ga0310888_107611481 | 3300031538 | Soil | FKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR |
| Ga0310886_100188251 | 3300031562 | Soil | ALRKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR |
| Ga0310686_1173588381 | 3300031708 | Soil | DSIDALRKATETSYFKGPDAVWVKLVIPTAPQGIGMDQFGPSVTQTSITVRR |
| Ga0307468_1006568201 | 3300031740 | Hardwood Forest Soil | YFKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0307477_105935181 | 3300031753 | Hardwood Forest Soil | IDALRKATETSYFKGPDAVWVKLVIPTALKGIGIDQFGPLDIQTSITVRR |
| Ga0310892_100055913 | 3300031858 | Soil | RKATETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR |
| Ga0310892_104199072 | 3300031858 | Soil | ETSYFKGPDAVWVKLVIPTAPNGVGRDQFGPLDTQASITVSR |
| Ga0306923_116946541 | 3300031910 | Soil | KATETSYFKGPDAVWVKLVIPTAPEGIGIDQFGPLDTQTSITVRR |
| Ga0308175_1005714721 | 3300031938 | Soil | SYFKGPDAVWVKLVIPTAPKGVGRDQFGPVDTQTSITVSR |
| Ga0308175_1009617941 | 3300031938 | Soil | LDSLRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR |
| Ga0310884_102815652 | 3300031944 | Soil | LRKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0310903_101783722 | 3300032000 | Soil | TETSYFKGPDAVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR |
| Ga0306922_114311621 | 3300032001 | Soil | DSIDALRKATETSYFKGPDTVWVKLVIPTAPKGIGIDQFGPSDTQTSITVRR |
| Ga0310902_109851022 | 3300032012 | Soil | RKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPSDTQASITVRR |
| Ga0310899_106682462 | 3300032017 | Soil | TETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPSDTQTSIVVRR |
| Ga0318510_102219351 | 3300032064 | Soil | FKGPDAVWVKLVIPTAPKGIGMDQFGPSDTQTSITVRR |
| Ga0310890_100354611 | 3300032075 | Soil | TETSYFKGPDAVWVKLVIPTAPTGVGRDQFGPSDTQASITVRR |
| Ga0315910_100737751 | 3300032144 | Soil | KATETSYFKGPDAVWVKLVIPTAPKGIGMDQFNSGTQASITVRR |
| Ga0315910_112540531 | 3300032144 | Soil | KATETSYFKGPDAVWVKLVVPTAPKGVGIDQFGPLDTQTSITVSR |
| Ga0315912_101757002 | 3300032157 | Soil | APDAVWVKLVIPTAPNGVGRDQFGPLDTQTSITVSR |
| Ga0311301_105538813 | 3300032160 | Peatlands Soil | SIDALRKATETSYFKGPDAVWVKLVIPTAPKGIGMDQFGPSVTQTSITVRR |
| Ga0307470_106286641 | 3300032174 | Hardwood Forest Soil | FKGPDAVWVKLVVTTAPKGIGMDQFNSGTQASITVRR |
| Ga0335085_106591571 | 3300032770 | Soil | ATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0335078_101445611 | 3300032805 | Soil | ETSYFKGPDAVWVKLVIPTAPQGIGMDQFGPQDTQASITVRR |
| Ga0335078_118560262 | 3300032805 | Soil | RKATETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPLDTQASITVSR |
| Ga0335080_113579911 | 3300032828 | Soil | SYFKGPDAVWVKLVIPTAPKGIGMDQFGPLDTQTSITVRR |
| Ga0335077_115645442 | 3300033158 | Soil | APDAVWVKLVIPTAPKGIGMDQFGPLDTQTSITVRR |
| Ga0310914_102913512 | 3300033289 | Soil | ETSYFKGPDAVWVKLVIATAPKGIGMDQFNSGTQASITVRR |
| Ga0310914_104349642 | 3300033289 | Soil | LRKATETSYFKGPDAVWVKLVIPTAPEGIGIDQFGPLDTQTSITVRR |
| Ga0316630_114416261 | 3300033487 | Soil | TSYFKGPDALWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0364935_0079271_882_989 | 3300034151 | Sediment | PDAVWVKLVIPTAPKGVGRDQFGPLDTQTSITVSR |
| Ga0314794_052786_3_131 | 3300034669 | Soil | ETSYFKGPDAVWVKLVIPTAPKGVGRDQFGPSDTQASITVRR |
| ⦗Top⦘ |