NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F009579

Metagenome / Metatranscriptome Family F009579

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009579
Family Type Metagenome / Metatranscriptome
Number of Sequences 316
Average Sequence Length 41 residues
Representative Sequence MSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Number of Associated Samples 205
Number of Associated Scaffolds 315

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 54.43 %
% of genes near scaffold ends (potentially truncated) 17.41 %
% of genes from short scaffolds (< 2000 bps) 77.85 %
Associated GOLD sequencing projects 190
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (54.430 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(21.519 % of family members)
Environment Ontology (ENVO) Unclassified
(31.329 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(35.127 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.07%    β-sheet: 0.00%    Coil/Unstructured: 44.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 315 Family Scaffolds
PF01510Amidase_2 11.11
PF00196GerE 3.49
PF12697Abhydrolase_6 1.59
PF08281Sigma70_r4_2 0.95
PF00440TetR_N 0.95
PF01243Putative_PNPOx 0.95
PF13649Methyltransf_25 0.95
PF01476LysM 0.95
PF09851SHOCT 0.63
PF08241Methyltransf_11 0.63
PF02518HATPase_c 0.63
PF01872RibD_C 0.63
PF13683rve_3 0.63
PF14329DUF4386 0.63
PF01061ABC2_membrane 0.63
PF16983MFS_MOT1 0.63
PF01850PIN 0.63
PF04191PEMT 0.63
PF05199GMC_oxred_C 0.63
PF13565HTH_32 0.63
PF13748ABC_membrane_3 0.63
PF00486Trans_reg_C 0.63
PF04075F420H2_quin_red 0.63
PF06224HTH_42 0.63
PF00403HMA 0.63
PF09719C_GCAxxG_C_C 0.63
PF01934HepT-like 0.32
PF01867Cas_Cas1 0.32
PF07883Cupin_2 0.32
PF12840HTH_20 0.32
PF00999Na_H_Exchanger 0.32
PF14534DUF4440 0.32
PF07676PD40 0.32
PF01053Cys_Met_Meta_PP 0.32
PF02452PemK_toxin 0.32
PF00296Bac_luciferase 0.32
PF01638HxlR 0.32
PF06897DUF1269 0.32
PF06863DUF1254 0.32
PF00724Oxidored_FMN 0.32
PF09360zf-CDGSH 0.32
PF01663Phosphodiest 0.32
PF12710HAD 0.32
PF00884Sulfatase 0.32
PF04439Adenyl_transf 0.32
PF01545Cation_efflux 0.32
PF07366SnoaL 0.32
PF00126HTH_1 0.32
PF13407Peripla_BP_4 0.32
PF11188DUF2975 0.32
PF02652Lactate_perm 0.32
PF13481AAA_25 0.32
PF01297ZnuA 0.32
PF02604PhdYeFM_antitox 0.32
PF01555N6_N4_Mtase 0.32
PF07452CHRD 0.32
PF13418Kelch_4 0.32
PF13847Methyltransf_31 0.32
PF13635DUF4143 0.32
PF00962A_deaminase 0.32
PF06736TMEM175 0.32
PF12680SnoaL_2 0.32
PF00155Aminotran_1_2 0.32
PF00144Beta-lactamase 0.32
PF01326PPDK_N 0.32
PF01402RHH_1 0.32
PF07992Pyr_redox_2 0.32
PF13701DDE_Tnp_1_4 0.32
PF08818DUF1801 0.32
PF00557Peptidase_M24 0.32
PF12728HTH_17 0.32
PF08327AHSA1 0.32
PF00211Guanylate_cyc 0.32
PF02661Fic 0.32
PF03992ABM 0.32

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 315 Family Scaffolds
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.63
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.63
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.63
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.63
COG2608Copper chaperone CopZInorganic ion transport and metabolism [P] 0.63
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.63
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.32
COG2008Threonine aldolaseAmino acid transport and metabolism [E] 0.32
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.32
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.32
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.32
COG2361HEPN domain protein, predicted toxin of MNT-HEPN systemDefense mechanisms [V] 0.32
COG2367Beta-lactamase class ADefense mechanisms [V] 0.32
COG2445Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 familyGeneral function prediction only [R] 0.32
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.32
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.32
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.32
COG3548Uncharacterized membrane proteinFunction unknown [S] 0.32
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.32
COG4100Cystathionine beta-lyase family protein involved in aluminum resistanceInorganic ion transport and metabolism [P] 0.32
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.32
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.32
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.32
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.32
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 0.32
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.32
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.32
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.32
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.32
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.32
COG0075Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucGAmino acid transport and metabolism [E] 0.32
COG01567-keto-8-aminopelargonate synthetase or related enzymeCoenzyme transport and metabolism [H] 0.32
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.32
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.32
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.32
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.32
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.32
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.32
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.32
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 0.32
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.32
COG1518CRISPR-Cas system-associated integrase Cas1Defense mechanisms [V] 0.32
COG1620L-lactate permeaseEnergy production and conversion [C] 0.32
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.32
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.32
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.32
COG1816Adenosine/6-amino-6-deoxyfutalosine deaminaseNucleotide transport and metabolism [F] 0.32
COG19022,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) familyEnergy production and conversion [C] 0.32
COG1921Seryl-tRNA(Sec) selenium transferaseTranslation, ribosomal structure and biogenesis [J] 0.32
COG1982Arginine/lysine/ornithine decarboxylaseAmino acid transport and metabolism [E] 0.32
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.32


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A54.43 %
All OrganismsrootAll Organisms45.57 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090009|LWAnN_F624WLL02I45FLNot Available504Open in IMG/M
2124908032|Perma_A_C_ConsensusfromContig90346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3954Open in IMG/M
3300001213|JGIcombinedJ13530_102557803Not Available750Open in IMG/M
3300001213|JGIcombinedJ13530_105025076Not Available580Open in IMG/M
3300001380|JGI1356J14229_10021923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi3891Open in IMG/M
3300002071|JGIcombinedJ21915_10041085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_142046Open in IMG/M
3300002549|JGI24130J36418_10025569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1764Open in IMG/M
3300002549|JGI24130J36418_10060476All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300002564|JGI24134J36421_10154859Not Available502Open in IMG/M
3300003321|soilH1_10281528All Organisms → cellular organisms → Bacteria2264Open in IMG/M
3300003461|P42013CM_1030080All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300003852|Ga0031655_10019512All Organisms → cellular organisms → Bacteria3276Open in IMG/M
3300003858|Ga0031656_10304353Not Available538Open in IMG/M
3300003993|Ga0055468_10056108Not Available1016Open in IMG/M
3300003995|Ga0055438_10012161All Organisms → cellular organisms → Bacteria → Proteobacteria1790Open in IMG/M
3300003998|Ga0055472_10235820Not Available574Open in IMG/M
3300003999|Ga0055469_10031299All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300004004|Ga0055451_10162139All Organisms → cellular organisms → Bacteria908Open in IMG/M
3300004012|Ga0055464_10131470All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300004015|Ga0055462_10112365Not Available806Open in IMG/M
3300004019|Ga0055439_10269997Not Available558Open in IMG/M
3300004022|Ga0055432_10006852All Organisms → cellular organisms → Bacteria1996Open in IMG/M
3300004025|Ga0055433_10058143All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300004063|Ga0055483_10211780Not Available631Open in IMG/M
3300004067|Ga0055485_10077896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4809Open in IMG/M
3300004072|Ga0055512_10128704Not Available540Open in IMG/M
3300004076|Ga0055522_10014271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1281Open in IMG/M
3300004114|Ga0062593_101476727All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300004155|Ga0066600_10080173All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300004156|Ga0062589_100704397All Organisms → cellular organisms → Bacteria → Terrabacteria group897Open in IMG/M
3300004463|Ga0063356_100492887Not Available1617Open in IMG/M
3300004481|Ga0069718_10037078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3973Open in IMG/M
3300004481|Ga0069718_10134462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6206Open in IMG/M
3300004481|Ga0069718_16026129Not Available1012Open in IMG/M
3300004481|Ga0069718_16254953All Organisms → cellular organisms → Bacteria10435Open in IMG/M
3300004778|Ga0062383_10124348Not Available1130Open in IMG/M
3300004778|Ga0062383_10495065Not Available612Open in IMG/M
3300004778|Ga0062383_10531657Not Available591Open in IMG/M
3300005183|Ga0068993_10410181Not Available501Open in IMG/M
3300005343|Ga0070687_100514966All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300005456|Ga0070678_101932912Not Available557Open in IMG/M
3300005458|Ga0070681_10553486Not Available1064Open in IMG/M
3300005487|Ga0074211_143978Not Available958Open in IMG/M
3300005487|Ga0074211_144395Not Available741Open in IMG/M
3300005537|Ga0070730_10093636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2087Open in IMG/M
3300005833|Ga0074472_10774793Not Available724Open in IMG/M
3300005836|Ga0074470_10154332Not Available755Open in IMG/M
3300005836|Ga0074470_10199612Not Available1520Open in IMG/M
3300005836|Ga0074470_10229867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia52327Open in IMG/M
3300005836|Ga0074470_11786831Not Available3397Open in IMG/M
3300005841|Ga0068863_101435391All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300005980|Ga0066798_10182992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi574Open in IMG/M
3300006055|Ga0097691_1077727Not Available1034Open in IMG/M
3300006057|Ga0075026_100828831Not Available563Open in IMG/M
3300006806|Ga0079220_12152309Not Available500Open in IMG/M
3300006917|Ga0075472_10617074Not Available544Open in IMG/M
3300006949|Ga0075528_10202860Not Available538Open in IMG/M
3300006950|Ga0075524_10375035Not Available627Open in IMG/M
3300006954|Ga0079219_10048088All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1819Open in IMG/M
3300007521|Ga0105044_10757960Not Available779Open in IMG/M
3300007775|Ga0102953_1331114Not Available641Open in IMG/M
3300007799|Ga0105049_11154852All Organisms → cellular organisms → Bacteria → Terrabacteria group506Open in IMG/M
3300009029|Ga0066793_10291774Not Available943Open in IMG/M
3300009029|Ga0066793_10408507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi779Open in IMG/M
3300009029|Ga0066793_10422830Not Available764Open in IMG/M
3300009029|Ga0066793_10879589Not Available507Open in IMG/M
3300009053|Ga0105095_10190321Not Available1124Open in IMG/M
3300009078|Ga0105106_10513999Not Available861Open in IMG/M
3300009078|Ga0105106_11032539All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300009083|Ga0105047_10037457All Organisms → cellular organisms → Bacteria6992Open in IMG/M
3300009085|Ga0105103_10495566Not Available685Open in IMG/M
3300009087|Ga0105107_10325850Not Available1070Open in IMG/M
3300009087|Ga0105107_10577449All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300009091|Ga0102851_11127199Not Available860Open in IMG/M
3300009153|Ga0105094_10122086Not Available1477Open in IMG/M
3300009165|Ga0105102_10705292Not Available567Open in IMG/M
3300009169|Ga0105097_10551452Not Available647Open in IMG/M
3300009868|Ga0130016_10022291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium8499Open in IMG/M
3300009870|Ga0131092_10105018All Organisms → cellular organisms → Bacteria3309Open in IMG/M
3300009870|Ga0131092_10153844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2522Open in IMG/M
3300009870|Ga0131092_10197314All Organisms → cellular organisms → Bacteria2109Open in IMG/M
3300009870|Ga0131092_10224127All Organisms → cellular organisms → Bacteria2721Open in IMG/M
3300009870|Ga0131092_10746872Not Available826Open in IMG/M
3300009873|Ga0131077_10312319All Organisms → cellular organisms → Bacteria1554Open in IMG/M
3300010044|Ga0126310_10031957All Organisms → cellular organisms → Bacteria2771Open in IMG/M
3300010166|Ga0126306_10369800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1117Open in IMG/M
3300010391|Ga0136847_13036561All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300011267|Ga0151621_1348594Not Available817Open in IMG/M
3300012092|Ga0136621_1355025Not Available568Open in IMG/M
3300012668|Ga0157216_10023660Not Available3188Open in IMG/M
3300012668|Ga0157216_10023660Not Available3188Open in IMG/M
3300012670|Ga0137335_1028198Not Available544Open in IMG/M
3300012680|Ga0136612_10471701Not Available637Open in IMG/M
3300012910|Ga0157308_10102408Not Available847Open in IMG/M
3300012964|Ga0153916_10497554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1289Open in IMG/M
3300012981|Ga0168316_110180Not Available1680Open in IMG/M
3300012985|Ga0164308_10927619Not Available769Open in IMG/M
3300013232|Ga0170573_10493538Not Available876Open in IMG/M
3300013315|Ga0173609_10124904Not Available1966Open in IMG/M
3300013315|Ga0173609_10291195Not Available685Open in IMG/M
3300014264|Ga0075308_1029042All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300014265|Ga0075314_1140011Not Available554Open in IMG/M
3300014296|Ga0075344_1071834Not Available661Open in IMG/M
3300014298|Ga0075341_1077063Not Available612Open in IMG/M
3300014298|Ga0075341_1121111Not Available532Open in IMG/M
3300014299|Ga0075303_1108805Not Available548Open in IMG/M
3300014304|Ga0075340_1008969All Organisms → cellular organisms → Bacteria1321Open in IMG/M
3300014304|Ga0075340_1083073Not Available618Open in IMG/M
3300014315|Ga0075350_1182472Not Available546Open in IMG/M
3300014318|Ga0075351_1106686Not Available612Open in IMG/M
3300014321|Ga0075353_1009939Not Available1544Open in IMG/M
3300014324|Ga0075352_1031119All Organisms → cellular organisms → Bacteria → Terrabacteria group1177Open in IMG/M
3300014490|Ga0182010_10130633Not Available1281Open in IMG/M
3300014496|Ga0182011_10191434All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1395Open in IMG/M
3300014496|Ga0182011_10688661Not Available645Open in IMG/M
3300014498|Ga0182019_10264490Not Available1136Open in IMG/M
3300014502|Ga0182021_10703503All Organisms → cellular organisms → Bacteria → Terrabacteria group1212Open in IMG/M
3300014502|Ga0182021_11207935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi911Open in IMG/M
3300014502|Ga0182021_11902430Not Available716Open in IMG/M
3300014839|Ga0182027_11256573Not Available741Open in IMG/M
3300014874|Ga0180084_1059248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_13770Open in IMG/M
3300014969|Ga0157376_11958985Not Available623Open in IMG/M
3300015191|Ga0167659_1086399Not Available543Open in IMG/M
3300015199|Ga0167647_1006456All Organisms → cellular organisms → Bacteria3820Open in IMG/M
3300015199|Ga0167647_1029601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1613Open in IMG/M
3300015208|Ga0167664_1000195All Organisms → cellular organisms → Bacteria29522Open in IMG/M
3300015208|Ga0167664_1037150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1653Open in IMG/M
3300015250|Ga0180072_1102616Not Available510Open in IMG/M
3300015360|Ga0163144_10994787Not Available804Open in IMG/M
3300015372|Ga0132256_101769430Not Available726Open in IMG/M
3300017787|Ga0183260_10246122Not Available1235Open in IMG/M
3300018055|Ga0184616_10341733Not Available564Open in IMG/M
3300018465|Ga0190269_10040261Not Available2140Open in IMG/M
3300018465|Ga0190269_11547004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium549Open in IMG/M
3300018481|Ga0190271_13831435Not Available503Open in IMG/M
3300020057|Ga0163151_10392482Not Available710Open in IMG/M
3300020163|Ga0194039_1094254Not Available1067Open in IMG/M
3300020186|Ga0163153_10109523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1616Open in IMG/M
3300020186|Ga0163153_10134936All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300020214|Ga0194132_10479786Not Available618Open in IMG/M
3300021081|Ga0210379_10079375Not Available1346Open in IMG/M
3300021329|Ga0210362_1267355Not Available608Open in IMG/M
3300021332|Ga0210339_1102608Not Available784Open in IMG/M
3300021332|Ga0210339_1605932Not Available628Open in IMG/M
3300022209|Ga0224497_10003470All Organisms → cellular organisms → Bacteria8824Open in IMG/M
3300022213|Ga0224500_10009451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium4483Open in IMG/M
3300022213|Ga0224500_10078833Not Available1275Open in IMG/M
3300022214|Ga0224505_10008525All Organisms → cellular organisms → Bacteria5086Open in IMG/M
3300022214|Ga0224505_10029282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-42398Open in IMG/M
3300025155|Ga0209320_10351763Not Available602Open in IMG/M
3300025159|Ga0209619_10026549All Organisms → cellular organisms → Bacteria3781Open in IMG/M
3300025160|Ga0209109_10457456All Organisms → cellular organisms → Bacteria → Terrabacteria group586Open in IMG/M
3300025174|Ga0209324_10148572Not Available1590Open in IMG/M
3300025309|Ga0209212_1005297All Organisms → cellular organisms → Bacteria15454Open in IMG/M
3300025318|Ga0209519_10349982Not Available851Open in IMG/M
3300025481|Ga0208079_1101559Not Available525Open in IMG/M
3300025484|Ga0208587_1070770Not Available756Open in IMG/M
3300025493|Ga0208610_118460Not Available625Open in IMG/M
3300025515|Ga0208733_125742Not Available520Open in IMG/M
3300025521|Ga0210083_1019750All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300025559|Ga0210087_1070764Not Available692Open in IMG/M
3300025573|Ga0210133_1102082Not Available633Open in IMG/M
3300025580|Ga0210138_1002117All Organisms → cellular organisms → Bacteria3597Open in IMG/M
3300025580|Ga0210138_1006317All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium2213Open in IMG/M
3300025692|Ga0209744_1086854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1096Open in IMG/M
3300025739|Ga0209745_1036641All Organisms → cellular organisms → Bacteria1924Open in IMG/M
3300025750|Ga0209747_1011230All Organisms → cellular organisms → Bacteria3913Open in IMG/M
3300025846|Ga0209538_1145916Not Available919Open in IMG/M
3300025846|Ga0209538_1212491Not Available716Open in IMG/M
3300025857|Ga0209014_10194906Not Available706Open in IMG/M
3300025865|Ga0209226_10114584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1221Open in IMG/M
3300025865|Ga0209226_10278541Not Available709Open in IMG/M
3300025912|Ga0207707_11152602Not Available629Open in IMG/M
3300025946|Ga0210126_104557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1128Open in IMG/M
3300025952|Ga0210077_1088214Not Available644Open in IMG/M
3300026048|Ga0208915_1014934Not Available680Open in IMG/M
3300027703|Ga0207862_1207140Not Available581Open in IMG/M
3300027819|Ga0209514_10000618All Organisms → cellular organisms → Bacteria70336Open in IMG/M
3300027831|Ga0209797_10107800All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1212Open in IMG/M
3300027841|Ga0209262_10167263All Organisms → cellular organisms → Bacteria1058Open in IMG/M
3300027843|Ga0209798_10123492Not Available1308Open in IMG/M
3300027857|Ga0209166_10229125All Organisms → cellular organisms → Bacteria → Terrabacteria group991Open in IMG/M
3300027885|Ga0209450_10095998Not Available1954Open in IMG/M
3300027887|Ga0208980_10219940Not Available1107Open in IMG/M
3300027896|Ga0209777_10014565All Organisms → cellular organisms → Bacteria8040Open in IMG/M
3300027896|Ga0209777_10022357All Organisms → cellular organisms → Bacteria6208Open in IMG/M
3300027896|Ga0209777_10029204All Organisms → cellular organisms → Bacteria5274Open in IMG/M
3300027896|Ga0209777_10044988Not Available4040Open in IMG/M
3300027896|Ga0209777_10489608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4909Open in IMG/M
3300027896|Ga0209777_10705565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium717Open in IMG/M
3300027896|Ga0209777_10715470All Organisms → cellular organisms → Bacteria → Terrabacteria group711Open in IMG/M
3300027897|Ga0209254_10020400All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae6041Open in IMG/M
3300027897|Ga0209254_10032357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4679Open in IMG/M
3300027897|Ga0209254_10071575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Saccharomonospora → Saccharomonospora marina → Saccharomonospora marina XMU152966Open in IMG/M
3300027897|Ga0209254_10093352All Organisms → cellular organisms → Bacteria2537Open in IMG/M
3300027900|Ga0209253_10286402Not Available1284Open in IMG/M
3300027900|Ga0209253_10340093All Organisms → cellular organisms → Bacteria → Terrabacteria group1155Open in IMG/M
3300027902|Ga0209048_10233417All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. RKAG2931320Open in IMG/M
3300027902|Ga0209048_10318009Not Available1086Open in IMG/M
3300027902|Ga0209048_10999452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium534Open in IMG/M
3300028803|Ga0307281_10058532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1226Open in IMG/M
3300028865|Ga0302291_10211823Not Available661Open in IMG/M
3300028868|Ga0302163_10031260All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300030006|Ga0299907_10220023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1564Open in IMG/M
3300030010|Ga0302299_10128886Not Available1382Open in IMG/M
3300030010|Ga0302299_10292742Not Available849Open in IMG/M
3300030047|Ga0302286_10504660Not Available613Open in IMG/M
3300030114|Ga0311333_10023755Not Available4224Open in IMG/M
3300030294|Ga0311349_10713241Not Available946Open in IMG/M
3300030620|Ga0302046_10087311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2538Open in IMG/M
3300031229|Ga0299913_10720857All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300031232|Ga0302323_100716979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Acrocarpospora1094Open in IMG/M
3300031232|Ga0302323_102618043Not Available576Open in IMG/M
3300031232|Ga0302323_103058973Not Available533Open in IMG/M
3300031256|Ga0315556_1003532All Organisms → cellular organisms → Bacteria8562Open in IMG/M
3300031341|Ga0307418_1001783Not Available6802Open in IMG/M
3300031450|Ga0272433_10029431All Organisms → cellular organisms → Bacteria4664Open in IMG/M
3300031521|Ga0311364_10019437All Organisms → cellular organisms → Bacteria → Terrabacteria group7500Open in IMG/M
3300031539|Ga0307380_10036313All Organisms → cellular organisms → Bacteria5620Open in IMG/M
3300031539|Ga0307380_10303238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1481Open in IMG/M
3300031539|Ga0307380_10306439Not Available1471Open in IMG/M
3300031539|Ga0307380_10739303Not Available822Open in IMG/M
3300031565|Ga0307379_10025367All Organisms → cellular organisms → Bacteria7246Open in IMG/M
3300031565|Ga0307379_10843814Not Available801Open in IMG/M
3300031565|Ga0307379_11537807Not Available528Open in IMG/M
3300031576|Ga0247727_10038443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium6269Open in IMG/M
3300031699|Ga0315535_1344334Not Available502Open in IMG/M
3300031707|Ga0315291_11482519Not Available535Open in IMG/M
3300031727|Ga0316576_10862186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300031746|Ga0315293_10102935All Organisms → cellular organisms → Bacteria2422Open in IMG/M
3300031746|Ga0315293_10111026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_70_132318Open in IMG/M
3300031746|Ga0315293_10647976All Organisms → cellular organisms → Bacteria → Terrabacteria group793Open in IMG/M
3300031772|Ga0315288_10081638Not Available3747Open in IMG/M
3300031772|Ga0315288_10091615All Organisms → cellular organisms → Bacteria → Terrabacteria group3498Open in IMG/M
3300031834|Ga0315290_10021113All Organisms → cellular organisms → Bacteria5045Open in IMG/M
3300031834|Ga0315290_10107731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas2358Open in IMG/M
3300031834|Ga0315290_10115462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Kocuria → Kocuria turfanensis2279Open in IMG/M
3300031834|Ga0315290_10810439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium800Open in IMG/M
3300031873|Ga0315297_10000667All Organisms → cellular organisms → Bacteria20204Open in IMG/M
3300031873|Ga0315297_10224144Not Available1553Open in IMG/M
3300031902|Ga0302322_103905322Not Available509Open in IMG/M
3300031903|Ga0307407_10313592All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1098Open in IMG/M
3300031918|Ga0311367_10496545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1252Open in IMG/M
3300031918|Ga0311367_10963523Not Available856Open in IMG/M
3300031965|Ga0326597_10062122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4642Open in IMG/M
3300031965|Ga0326597_11158788All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300031965|Ga0326597_11462678Not Available658Open in IMG/M
3300031997|Ga0315278_10036545All Organisms → cellular organisms → Bacteria4761Open in IMG/M
3300031997|Ga0315278_10042804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4414Open in IMG/M
3300031997|Ga0315278_10057089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3839Open in IMG/M
3300031997|Ga0315278_10164820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales2269Open in IMG/M
3300031997|Ga0315278_10301230Not Available1656Open in IMG/M
3300031997|Ga0315278_10323517Not Available1594Open in IMG/M
3300031997|Ga0315278_10603465All Organisms → cellular organisms → Bacteria → Terrabacteria group1123Open in IMG/M
3300031997|Ga0315278_10971761Not Available847Open in IMG/M
3300031997|Ga0315278_11307386Not Available706Open in IMG/M
3300031997|Ga0315278_11323137Not Available701Open in IMG/M
3300031997|Ga0315278_11361236Not Available689Open in IMG/M
3300031997|Ga0315278_11504047Not Available647Open in IMG/M
3300031997|Ga0315278_11505474Not Available647Open in IMG/M
3300031997|Ga0315278_11988310Not Available543Open in IMG/M
3300032018|Ga0315272_10095984Not Available1368Open in IMG/M
3300032018|Ga0315272_10568794Not Available570Open in IMG/M
3300032018|Ga0315272_10584954Not Available562Open in IMG/M
3300032061|Ga0315540_10030378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2663Open in IMG/M
3300032061|Ga0315540_10221889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales810Open in IMG/M
3300032143|Ga0315292_10360186Not Available1218Open in IMG/M
3300032143|Ga0315292_10395080Not Available1160Open in IMG/M
3300032143|Ga0315292_10426782Not Available1114Open in IMG/M
3300032143|Ga0315292_11005371Not Available692Open in IMG/M
3300032156|Ga0315295_10311854Not Available1595Open in IMG/M
3300032163|Ga0315281_10359672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_2_20CM_2_71_61576Open in IMG/M
3300032163|Ga0315281_10453867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Cellulomonadaceae → Cellulomonas1372Open in IMG/M
3300032163|Ga0315281_12164241Not Available527Open in IMG/M
3300032164|Ga0315283_10974657Not Available899Open in IMG/M
3300032164|Ga0315283_11022839Not Available873Open in IMG/M
3300032164|Ga0315283_11483998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4695Open in IMG/M
3300032164|Ga0315283_12044884Not Available568Open in IMG/M
3300032173|Ga0315268_10009452All Organisms → cellular organisms → Bacteria10113Open in IMG/M
3300032173|Ga0315268_10441380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Angustibacter → unclassified Angustibacter → Angustibacter sp. Root4561278Open in IMG/M
3300032173|Ga0315268_11771753Not Available631Open in IMG/M
3300032256|Ga0315271_10143834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1863Open in IMG/M
3300032256|Ga0315271_10636230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria913Open in IMG/M
3300032256|Ga0315271_10732338Not Available850Open in IMG/M
3300032256|Ga0315271_11083014Not Available692Open in IMG/M
3300032275|Ga0315270_10409137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi866Open in IMG/M
3300032275|Ga0315270_10497115Not Available786Open in IMG/M
3300032275|Ga0315270_10765656Not Available634Open in IMG/M
3300032275|Ga0315270_10927436Not Available576Open in IMG/M
3300032275|Ga0315270_11062322Not Available537Open in IMG/M
3300032342|Ga0315286_10422487All Organisms → cellular organisms → Bacteria1398Open in IMG/M
3300032342|Ga0315286_12180408Not Available510Open in IMG/M
3300032397|Ga0315287_10179051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia2464Open in IMG/M
3300032397|Ga0315287_10648069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1249Open in IMG/M
3300032397|Ga0315287_10695025All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1201Open in IMG/M
3300032397|Ga0315287_11221036Not Available864Open in IMG/M
3300032397|Ga0315287_12495023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4555Open in IMG/M
3300032397|Ga0315287_12739373Not Available523Open in IMG/M
3300032401|Ga0315275_12154923Not Available584Open in IMG/M
3300032516|Ga0315273_11535210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4817Open in IMG/M
3300032516|Ga0315273_12148607All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4657Open in IMG/M
3300033233|Ga0334722_10004801All Organisms → cellular organisms → Bacteria13913Open in IMG/M
3300033233|Ga0334722_10021705All Organisms → cellular organisms → Bacteria5471Open in IMG/M
3300033233|Ga0334722_10102832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2168Open in IMG/M
3300033233|Ga0334722_10358031Not Available1058Open in IMG/M
3300033413|Ga0316603_11156295Not Available733Open in IMG/M
3300033521|Ga0316616_101886346Not Available788Open in IMG/M
3300033891|Ga0334811_101013Not Available737Open in IMG/M
3300034053|Ga0373890_026684Not Available853Open in IMG/M
3300034054|Ga0373891_078988Not Available547Open in IMG/M
3300034077|Ga0373899_006193All Organisms → cellular organisms → Bacteria → Terrabacteria group1081Open in IMG/M
3300034077|Ga0373899_008525All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300034125|Ga0370484_0012161All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1862Open in IMG/M
3300034165|Ga0364942_0102450Not Available926Open in IMG/M
3300034281|Ga0370481_0005631Not Available3284Open in IMG/M
3300034773|Ga0364936_073437Not Available648Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment21.52%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands6.96%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment6.01%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil5.38%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.43%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands4.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.48%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.85%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.53%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.22%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.58%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.58%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.58%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.58%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.58%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.27%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.27%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment1.27%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.27%
Sediment SlurryEngineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry1.27%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.95%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.95%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.95%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.95%
SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Sediment0.63%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.63%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.63%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.63%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.63%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.63%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.63%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.63%
Serpentinite Rock And FluidEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid0.63%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.63%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.63%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.63%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.32%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment0.32%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater0.32%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.32%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.32%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.32%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.32%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.32%
SedimentEnvironmental → Aquatic → Freshwater → Groundwater → Acid Mine Drainage → Sediment0.32%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.32%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.32%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.32%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.32%
Ore Pile And Mine Drainage Contaminated SoilEnvironmental → Terrestrial → Soil → Unclassified → Mine Drainage → Ore Pile And Mine Drainage Contaminated Soil0.32%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.32%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.32%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.32%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.32%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.32%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.32%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.32%
Weathered Mine TailingsEnvironmental → Terrestrial → Geologic → Mine → Unclassified → Weathered Mine Tailings0.32%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.32%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.32%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.32%
SedimentEngineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment0.32%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090009Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrateEnvironmentalOpen in IMG/M
2124908032Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Perma_allEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001380Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 mEnvironmentalOpen in IMG/M
3300002071Barrow Graham LP Ref core NGADG0011-312 (Barrow Graham LP Ref core NGADG0011-312,NGADG0011-212, ASSEMBLY_DATE=20131010)EnvironmentalOpen in IMG/M
3300002549Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212EnvironmentalOpen in IMG/M
3300002564Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003461Ore pile and mine drainage contaminated soil microbial communities from Mina do Sossego, Brazil - P4 sampleEnvironmentalOpen in IMG/M
3300003852Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HBEnvironmentalOpen in IMG/M
3300003858Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DIEnvironmentalOpen in IMG/M
3300003993Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2EnvironmentalOpen in IMG/M
3300003995Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300003999Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2EnvironmentalOpen in IMG/M
3300004004Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D2EnvironmentalOpen in IMG/M
3300004012Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300004015Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004025Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004063Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004067Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004072Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleA_D2EnvironmentalOpen in IMG/M
3300004076Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004155Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004481Combined Assembly of Gp0112041, Gp0112042, Gp0112043EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005183Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005487Sediment microbial communities from Lake Washington, Seattle, Washington, USA - Methanol enrichmentEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005980Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006057Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006949Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16BEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300007775Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_D2_MGEnvironmentalOpen in IMG/M
3300007799Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-06EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009083Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300009870Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plantEngineeredOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011267Acid mine drainage microbial communities from Malanjkhand copper mine, India - M16 k-mer-51EnvironmentalOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012670Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT293_2EnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012981Weathered mine tailings microbial communities from Hibbing, Minnesota, USA - DT8EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013232Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA ? S1EngineeredOpen in IMG/M
3300013315Sediment microbial communities from Acid Mine Drainage holding pond in Pittsburgh, PA, USA - 1BEngineeredOpen in IMG/M
3300014264Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rdEnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014296Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300014298Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300014324Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1EnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015191Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-10 : a,b,c samples pooled, hydrological sediment from glacier outflow)EnvironmentalOpen in IMG/M
3300015199Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)EnvironmentalOpen in IMG/M
3300015208Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Samples st-15,16,16 pooled, 1st-3rd transect points, snow/rock/ice interface)EnvironmentalOpen in IMG/M
3300015250Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293B_16_10DEnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020057Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2EnvironmentalOpen in IMG/M
3300020163Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8mEnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300020214Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80mEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021329Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021332Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022209Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022213Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025159Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025174Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 3EnvironmentalOpen in IMG/M
3300025309Soil microbial communities from Rifle, Colorado, USA - Groundwater C2EnvironmentalOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025481Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025484Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025493Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Jul_8A2 (SPAdes)EnvironmentalOpen in IMG/M
3300025515Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR11Jul_8B1 (SPAdes)EnvironmentalOpen in IMG/M
3300025521Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025573Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025692Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes)EnvironmentalOpen in IMG/M
3300025739Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025750Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-311 (SPAdes)EnvironmentalOpen in IMG/M
3300025846Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025857Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025865Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025946Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025952Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026048Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027819Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 m (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027841Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Low cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028865Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_4EnvironmentalOpen in IMG/M
3300028868Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030620Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111EnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031232Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3EnvironmentalOpen in IMG/M
3300031256Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1603-10EnvironmentalOpen in IMG/M
3300031341Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1602-20EnvironmentalOpen in IMG/M
3300031450Rock endolithic microbial communities from Victoria Land, Antarctica - University Valley sudEnvironmentalOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031699Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031727Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5Host-AssociatedOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300033413Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCTEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034053Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A1A4.3EngineeredOpen in IMG/M
3300034054Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A3A4.1EngineeredOpen in IMG/M
3300034077Uranium-contaminated sediment microbial communities from bioreactor in Oak Ridge, Tennessee, United States - A5A4.3EngineeredOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M
3300034165Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17EnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M
3300034773Sediment microbial communities from East River floodplain, Colorado, United States - 4_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LWAnN_077436602088090009Freshwater SedimentVSGIELVLAFLAGVVMGGALDRFVLPLLVDVWIDRLRRHGR
Perma_A_C_012194302124908032SoilMSGVELALAFLSGVVTGVLLDRWLLPPLVDAWIDRMRRHGR
JGIcombinedJ13530_10255780313300001213WetlandMSEVGLVLAFLSGVVMSVLLDRFVLPLLVDAWIDR
JGIcombinedJ13530_10502507623300001213WetlandMNGVELVLAFLAGVVMGGTLDRFVLPLLVDAWIDR
JGI1356J14229_1002192333300001380GroundwaterMSEVELALAFLSGVVTGVLLDRWVLPPLVDAWIDRMRWHGR*
JGIcombinedJ21915_1004108533300002071Arctic Peat SoilMSEVELAIAFFSGVVMGILLDRWVLPPLVDAWIDRLRRHGR*
JGI24130J36418_1002556923300002549Arctic Peat SoilMSEVELAVAFLSGVIMGVVLDRWLLPRLVDAWIDRMRRHGQ*
JGI24130J36418_1006047623300002549Arctic Peat SoilMSEVDLALAFLSGVVTGVLLDRWVLPPLVDAWIDRMRRHGQ*
JGI24134J36421_1015485913300002564Arctic Peat SoilQLHGGPMSGVELGLAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR*
soilH1_1028152833300003321Sugarcane Root And Bulk SoilMNGLELVVAFLAGVLMGGALDFFVLPLLVDAWIDRRRRHER*
P42013CM_103008033300003461Ore Pile And Mine Drainage Contaminated SoilMNGLELVVAFLAGVVMGGALDFFVLPLLVDAWIDRRRRHGR*
Ga0031655_1001951243300003852Freshwater Lake SedimentMSGVELALAFFSGVVLGILLDRWLLPPLVDAWIDRMRRHGR*
Ga0031656_1030435323300003858Freshwater Lake SedimentMSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0055468_1005610813300003993Natural And Restored WetlandsMSGVELVLAFLAGVVMGGALDRFVLPRLVDAWIDRLRRHGR*
Ga0055438_1001216113300003995Natural And Restored WetlandsMNGLELAVAFLAGVLMGGALDFFVLPLVVDAWIDRRRRHG
Ga0055472_1023582013300003998Natural And Restored WetlandsMSGIELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0055469_1003129923300003999Natural And Restored WetlandsMSGLELVLAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHGR*
Ga0055451_1016213913300004004Natural And Restored WetlandsMSGVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0055464_1013147023300004012Natural And Restored WetlandsMSGIELVAAFLAGVGMGIALDRWLLPSLVDAWIDRLRRHGR*
Ga0055462_1011236513300004015Natural And Restored WetlandsMSGIVLVLAFLSGVVMGGALDRLVLPLLVDAWIDRLRRHGR*
Ga0055439_1026999733300004019Natural And Restored WetlandsMSEVELVVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0055432_1000685223300004022Natural And Restored WetlandsMSGVELALAFLAGVAMGIALDRVVLPMLVDAWIDRLRRHGR*
Ga0055433_1005814343300004025Natural And Restored WetlandsVVELVLAFLAGVVMGGALDRWLLPLLVDAWIDRQRRHGR*
Ga0055483_1021178013300004063Natural And Restored WetlandsVNGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHGR*
Ga0055485_1007789623300004067Natural And Restored WetlandsMSGVELVAAFLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR*
Ga0055512_1012870423300004072Natural And Restored WetlandsMSGIELVAAFFAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0055522_1001427143300004076Natural And Restored WetlandsMSGVELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0062593_10147672723300004114SoilMSEVDLAIAFLAGIVLGLVLDRLLLPPLVDAWIDRMRRHGR*
Ga0066600_1008017323300004155FreshwaterMSGVELVLAFLAGVVMGGALDRFVLPLLVNAWIDRLRRHGR*
Ga0062589_10070439713300004156SoilMSGFELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHVTRP
Ga0063356_10049288723300004463Arabidopsis Thaliana RhizosphereMSEVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0069718_1003707893300004481SedimentMTGVELVAAFLAGVVMGGALDRFVLPVLVDAWIDRLRPA*
Ga0069718_1013446253300004481SedimentMSGVELALAFLAGVAMGIALDRWLLPPIVDAWIDGLRRHGR*
Ga0069718_1602612933300004481SedimentMSGLELVLAFLAGVLMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0069718_1625495323300004481SedimentMSGVELVAAFLAGVVMGGALDRFVLPLLVDAWIDRMRRHGR*
Ga0062383_1012434823300004778Wetland SedimentMSEVELALAFLTGVVMGGALDRFVLPLLVDAWVDRLRRHGR*
Ga0062383_1049506513300004778Wetland SedimentMSGLELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0062383_1053165713300004778Wetland SedimentVSGIELVLAFLAGVAMGIALDHWLLPPLVDAWIDRLRRLG
Ga0068993_1041018123300005183Natural And Restored WetlandsMSGVDLLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0070687_10051496613300005343Switchgrass RhizosphereMNGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGQ*
Ga0070678_10193291223300005456Miscanthus RhizosphereMSEVDLALAFLTGIVLGLVLDRLLLPPLVDAWIARTRRHGR*
Ga0070681_1055348613300005458Corn RhizosphereMNGLELVLAFLAGVVMGGVPDRLVVPLIVDAWIDRLRRHGR*
Ga0074211_14397833300005487SedimentMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0074211_14439513300005487SedimentGVELILAFLVGGVMGGALDRFVLPLLVDAWFDRLRRHGR*
Ga0070730_1009363623300005537Surface SoilMSGVELVLAFLAGVAMGIALDRFVLPLLVDAWIDRLRRHER*
Ga0074472_1077479333300005833Sediment (Intertidal)MNGVELILAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0074470_1015433233300005836Sediment (Intertidal)MSGAELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLCRHGR*
Ga0074470_1019961233300005836Sediment (Intertidal)MSGVELILAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0074470_1022986723300005836Sediment (Intertidal)MSVVELVLAFLAGVVMGGALDRWLLPLLVDAWIDRQRRHGR*
Ga0074470_1178683133300005836Sediment (Intertidal)MSGLDLVLAFLAGVVMGGALDRFVLPLLVDAWLDRLRRHGR*
Ga0068863_10143539133300005841Switchgrass RhizosphereCDRPMSEVDLAVAFLTGIVLGLVLDRLLLPPLVDAWIARSRRHGR*
Ga0066798_1018299223300005980SoilMSGVELALAFLSGVVMGILLDRWLLPSLVDAWIDRMRRHGR*
Ga0097691_107772713300006055Arctic Peat SoilMSGVELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR*
Ga0075026_10082883113300006057WatershedsELALAFLAGVAMGGALDHFVLPLLVDAWIGRRRHGR*
Ga0079220_1215230913300006806Agricultural SoilPMSEVELVIAFLGGVVMGGALDFFVLPLLVDAWIDRLRRHGR*
Ga0075472_1061707423300006917AqueousVELVAAFLAGVAMGGALDRFVLPLLVDAWIDRLRRHER*
Ga0075528_1020286013300006949Arctic Peat SoilMSDVDLALAFLSGVATGVLLDRWVLPPLVDLWIDRMRRHGQ*
Ga0075524_1037503523300006950Arctic Peat SoilMSVVELALAFLSGVVTGVLLDRWVLPPLVDAWIDRMRRHGQ*
Ga0079219_1004808823300006954Agricultural SoilMNGLELVLAFLAGVLMGGALDFFVLPLLVDAWIDRRRRHGR*
Ga0105044_1075796033300007521FreshwaterMSEVELVLAFLSGVAMGIALDRWLLPSLVYAWIDQLRRHGR*
Ga0102953_133111413300007775SoilMSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHWR*
Ga0105049_1115485213300007799FreshwaterMSEVELVLAFLSGVAMGIVLDRWLLPPLVDAWITRLRRHG
Ga0066793_1029177433300009029Prmafrost SoilMSEVELALAFLWGVGMGIALDRWLLPPLVDAWIDRLRRHGR*
Ga0066793_1040850713300009029Prmafrost SoilMSGVELALAFLSGVVMGILLDRWLLPPLVDAWIDRLRRHGR*
Ga0066793_1042283023300009029Prmafrost SoilMSEVELVLAFLAGVVMGGALDRFVLPPLVDAWIDRLRWHGQ*
Ga0066793_1087958913300009029Prmafrost SoilLRGGPMSGVELALALVSGVVMGILLDRWLLPSLVDAWIDRMRRHGR*
Ga0105095_1019032113300009053Freshwater SedimentMSEVELALAFLSGVVMGILLDRWLLPPLVDAWLDRMRRHGR*
Ga0105106_1051399923300009078Freshwater SedimentLGGPVSGLELVLAFLAGVVMGSGLDRFVLPLLVDAWIDRLRRDGR*
Ga0105106_1103253913300009078Freshwater SedimentPCWFPMSGLELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0105047_1003745763300009083FreshwaterMSGLELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0105103_1049556613300009085Freshwater SedimentMSEVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0105107_1032585033300009087Freshwater SedimentMSGIELVLAFLAGVVMGGALDRFVLPLRVDAWIDRLRRYGR*
Ga0105107_1057744923300009087Freshwater SedimentVSGVELVLAFLAGVVMGGALDRFVLPRPVDAWIDRLRRHGR*
Ga0102851_1112719923300009091Freshwater WetlandsMSGVELVLAFLAGVVMGGALDRFVLPILVDAWIDRL
Ga0105094_1012208613300009153Freshwater SedimentMSGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDRVRRHGR*
Ga0105102_1070529223300009165Freshwater SedimentMSGVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRVRRHGR*
Ga0105097_1055145213300009169Freshwater SedimentMSGVELVLAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR*
Ga0130016_10022291133300009868WastewaterMSGIELVAAFLAGVVMGVILDHVVLPLLVDAWIDRLHRHGR*
Ga0131092_1010501843300009870Activated SludgeMSVVELVGAFLAGVAMGIAFDRWLLPALVDVWLDRLPRHGR*
Ga0131092_1015384463300009870Activated SludgeMSGVELVAAFLAGVAMGIALDRWLLPSLVDVWIDGLRRHGR*
Ga0131092_1019731433300009870Activated SludgeMSGAEPVLAFLAGVAMGIALDRFVLPVLVDAWIDRLRRHGR*
Ga0131092_1022412723300009870Activated SludgeMNGLELVFAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0131092_1074687213300009870Activated SludgeMSGAEPVLAFLAGVAMGIALDRFVLPVLVDAWIDGLRRHGR*
Ga0131077_1031231933300009873WastewaterMSGLDLIVAFLAGVVMGGALDFFVLPLLVDAWIDRLHRHGR*
Ga0126310_1003195743300010044Serpentine SoilMSGMDLVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0126306_1036980013300010166Serpentine SoilMSGVELVLAFLAGVVMAGALDRFVLPLLVDAWIDRLRRHGR*
Ga0136847_1303656123300010391Freshwater SedimentMTGVELALAFLSGVVMGILLDRWLLPLLVDAWIDRLRRHGR*
Ga0151621_134859413300011267SedimentSPMNGLELVVAFLAGVVMGIALDRWLLPPLVDAWIDRLRRHER*
Ga0136621_135502523300012092Polar Desert SandMSAVDLAFAFLTGVAMGIVLDRWLLPPLVDAWITRLRRHGR*
Ga0157216_1002366013300012668Glacier Forefield SoilMSGVELILAFLAGVVMGVALDRWLLPPLVDAWIDRMRRHGR*
Ga0157216_1002366063300012668Glacier Forefield SoilMSWVELALAFLSGVVTGILLDRWLLPLLVDAWIDRMRRHGR*
Ga0137335_102819823300012670SoilMSGVELVLAFLAVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0136612_1047170113300012680Polar Desert SandMSGAELVAAFLAGVAMGIALDRFVLPLLVDAWIDRLRRHER*
Ga0157308_1010240823300012910SoilMNGLELVLAFFTGVLLGGALDRFVLPVLVDAWIDRTRRHGR*
Ga0153916_1049755413300012964Freshwater WetlandsMSGVELALAFFSGVVMGILLDRWLLPPLVDAWIDRMRRHGR*
Ga0168316_11018033300012981Weathered Mine TailingsMNGLELVLAFLTGVLMGGALDFFVLPLVVDAWIDGRRRHGR*
Ga0164308_1092761923300012985SoilMSEVELLVAFLAGVVMGGALDRFVLPLVVDAWIDRLRRHGR*
Ga0170573_1049353823300013232SedimentMSGVELTLAFLGGVVMGGALDRFALPLLVDLWIDRLRRHGR*
Ga0173609_1012490433300013315SedimentMSGVELTLAFLGGVVMGGALDRFVLPLLVDLWIDRLRRHGR*
Ga0173609_1029119523300013315SedimentMNGLDLVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0075308_102904223300014264Natural And Restored WetlandsVSGIELVAAFLAGVLMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0075314_114001123300014265Natural And Restored WetlandsVSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0075344_107183433300014296Natural And Restored WetlandsMSGFELVLAFLAGVVMGGALDRFVLPLLVDAWIDRRRRHGR*
Ga0075341_107706333300014298Natural And Restored WetlandsMNGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0075341_112111113300014298Natural And Restored WetlandsMSGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0075303_110880533300014299Natural And Restored WetlandsELAVAFLAGVLMGGALDFFVLPLVVDAWIDRRRRHGR*
Ga0075340_100896913300014304Natural And Restored WetlandsMSGIELVLAFLAGVVMGGALDRFVVPLLVDAWIDRLRRQGR*
Ga0075340_108307313300014304Natural And Restored WetlandsMSEVALLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0075350_118247233300014315Natural And Restored WetlandsMTGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0075351_110668623300014318Natural And Restored WetlandsMSGSELALAFLSGVAMGIVLDHQLLPPLVDAWIDRLRQHGR*
Ga0075353_100993943300014321Natural And Restored WetlandsMSGVELVLAFLAGVVTGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0075352_103111923300014324Natural And Restored WetlandsMSGIELVLAFLAGVIMGGALDRFVLPLLVDAWIDRLRRHGR*
Ga0182010_1013063333300014490FenMSEIDLALAFLSGVVTGVLLDRWVLPPLVDMWIERTRRHGQ*
Ga0182011_1019143413300014496FenMSEIDLDLAFLSGVVTGVLLDRWVLPPLVDMWIERTRRHGQ*
Ga0182011_1068866123300014496FenMSEVDLALAFLSGVATGVLLDRWVLPPLVDAWIDRMRRHGR*
Ga0182019_1026449013300014498FenMSEVDLALAFLAGVVMGILLDRWVLPPLVDAWIDRLRRHGR*
Ga0182021_1070350323300014502FenMELVLAFLAGVVMGGALDRFVLPLVVDAWIDRLRRHGR*
Ga0182021_1120793513300014502FenMSGVELALAFLSGVAAGVLLDRWVPPPLVDAWIDRMRRHGR*
Ga0182021_1190243023300014502FenMSGVELALAFLAGVGVGILLDRWLLPPLVDAWIDRLRRHGR*
Ga0182027_1125657323300014839FenMSEIDLALAFLSGVVTGVLLDRWVLPPLVDMWTERMRRHGQ*
Ga0180084_105924813300014874SoilMSGIEFVLAFLAGVDMGGDLERFVLPLLVDAWIDRLRRHGR*
Ga0157376_1195898523300014969Miscanthus RhizosphereMSEVDLAIAFLTGIVLGLVLDRLLLPPLVDAWIDRMRRHGR*
Ga0167659_108639923300015191Glacier Forefield SoilMSEVELAFAFLSGVVTGILLDRWLLPPLVDLWIDRLRRHGR*
Ga0167647_100645673300015199Glacier Forefield SoilMSGIALALLSGVVTGVLLDRWVLPALVDLWIDRMRRHGQ*
Ga0167647_102960133300015199Glacier Forefield SoilMSGVELVLAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHGR*
Ga0167664_1000195203300015208Glacier Forefield SoilMSGVELVLTFLAGVGMGIALDRWLLPPLVDAWIDRLRRHGQ*
Ga0167664_103715033300015208Glacier Forefield SoilMSGVELALAFLSGVVTGIVLDRWLLPSLVDAWIYRMRRHGR*
Ga0180072_110261623300015250SoilMSGLELPLAFLAGDVKSGALDRFVLPLLVDAWIDRLRRHGR*
Ga0163144_1099478733300015360Freshwater Microbial MatMSAGDLAFAFLTGVAMGIVLDRWLLPPLVDAWITRLRRHGR*
Ga0132256_10176943013300015372Arabidopsis RhizosphereVSAAELLITFLSGIGMGIALDRWLIPPLVDAWIDHVRRYGR*
Ga0183260_1024612223300017787Polar Desert SandMSGVELVLAFLAGVAMGIALDRWLLPPLVDAWITRARRHGQ
Ga0184616_1034173313300018055Groundwater SedimentMSEVELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR
Ga0190269_1004026153300018465SoilMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0190269_1154700413300018465SoilMGAMSGLELVLAFLAGVVMGGALDRFVLPLLVDAW
Ga0190271_1383143513300018481SoilMSGEELILAFLAGVVMGGALDRFVLPLIVDVWIDRTQRHGR
Ga0163151_1039248223300020057Freshwater Microbial MatQPRWGSMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0194039_109425433300020163Anoxic Zone FreshwaterMSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0163153_1010952313300020186Freshwater Microbial MatMSAGDLAFAFLTGVGMGIALDRWLLPPLVDAWIDRLRRHGQ
Ga0163153_1013493623300020186Freshwater Microbial MatMSEIELAVAFLSGVVTGVLLDRWLLPPLVDLWIARLRRHGR
Ga0194132_1047978623300020214Freshwater LakeMNGLELVLAFLAGVVMGGALDFFVLPLLVDAWIDRLRRHGR
Ga0210379_1007937523300021081Groundwater SedimentMSGVELVVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0210362_126735513300021329EstuarineMNGLELVLAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR
Ga0210339_110260813300021332EstuarineHLPDGPMSGLELVLAFLAGVLMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0210339_160593223300021332EstuarineMSGAELVLAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR
Ga0224497_1000347093300022209SedimentVSGIELALAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0224500_1000945153300022213SedimentMSGVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0224500_1007883343300022213SedimentMSGVELVAAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHER
Ga0224505_1000852523300022214SedimentMNGLELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0224505_1002928253300022214SedimentVSGVELVAAFLAGVAMGGALDRFVLPLLVDAWIDRLRRHER
Ga0209320_1035176313300025155SoilMSGVELALAFLAGAVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209619_1002654953300025159SoilMSGVELVAAFLAGVVMGGALDRYVLPLLVDAWIDRLRRHGR
Ga0209109_1045745613300025160SoilRGNPMSGVELVLAFLAGAVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209324_1014857233300025174SoilMSGVELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209212_1005297153300025309SoilMSGIELVAAFLAGVGMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209519_1034998223300025318SoilMSGLELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0208079_110155913300025481Arctic Peat SoilMSEVELAVAFLSGVIMGVVLDRWLLPRLVDAWIDRMRRHGQ
Ga0208587_107077023300025484Arctic Peat SoilMSEVELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGQ
Ga0208610_11846013300025493Serpentinite Rock And FluidMSEVELVLAFLSGVAMGIALDRWLLPPLVDAWIDRLSRHGR
Ga0208733_12574223300025515Serpentinite Rock And FluidMSGVELLLAFLAGVVLGIALDRWLLPPLVDAWIDRLRRRGR
Ga0210083_101975053300025521Natural And Restored WetlandsGSMSVVELVLAFLAGVVMGGALDRWLLPLLVDAWIDRQRRHGR
Ga0210087_107076423300025559Natural And Restored WetlandsMSGVELVLAFLAGVVMGGALDRFVLPRLVDAWIDRLRRHGR
Ga0210133_110208213300025573Natural And Restored WetlandsMSGIVLVLAFLSGVVMGGALDRLVLPLLVDAWIDRLRRHGR
Ga0210138_100211743300025580Natural And Restored WetlandsMSGSELALAFLSGVAMGIVLDHQLLPPLVDAWIDRLRQHGR
Ga0210138_100631753300025580Natural And Restored WetlandsPRLRPMNGLELAVAFLAGVLMGGALDFFVLPLVVDAWIDRRRRHGR
Ga0209744_108685433300025692Arctic Peat SoilMSGVELGLAFLSGVVMGILLDRWLLPPLVDAWIHRMRRHGR
Ga0209745_103664143300025739Arctic Peat SoilMSGVELGLAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR
Ga0209747_101123053300025750Arctic Peat SoilMSEVELAIAFFSGVVMGILLDRWLLPPLVDAWIDRMRRHGR
Ga0209538_114591623300025846Arctic Peat SoilMSEVELALAFLWGVGMGIALDRWLLPPLVDAWIDRLRRHGR
Ga0209538_121249123300025846Arctic Peat SoilMSDVDLVLAFLAGVVTGVLLDRWLLPPLVDAWIDRMRRHGR
Ga0209014_1019490623300025857Arctic Peat SoilMSGVELALAFLSGVVTGVLLDRWVLPPLVDAWIDRLRRHGQ
Ga0209226_1011458443300025865Arctic Peat SoilPRRQPDEGSMSEIELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR
Ga0209226_1027854123300025865Arctic Peat SoilMSEVELALAFLAGVVMGGALDRFVLPLLVDVWIDRLRRHGR
Ga0207707_1115260223300025912Corn RhizosphereMNGLELVLAFLAGVVMGGVPDRLVVPLIVDAWIDRLRRHGR
Ga0210126_10455723300025946Natural And Restored WetlandsMSEVELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0210077_108821413300025952Natural And Restored WetlandsVNGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHGR
Ga0208915_101493413300026048Natural And Restored WetlandsMSGVELALAFLAGVAMGIALDRVVLPMLVDAWIDRLRRHGR
Ga0207862_120714013300027703Tropical Forest SoilVTVVELALAFLWGVAMGVALDRWVLPPIVDAWVDRMRRHGR
Ga0209514_10000618103300027819GroundwaterMSEVELALAFLSGVVTGVLLDRWVLPPLVDAWIDRMRWHGR
Ga0209797_1010780013300027831Wetland SedimentMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHER
Ga0209262_1016726323300027841FreshwaterMSGVELVLAFLAGVVMGGALDRFVLPLLVNAWIDRLRRHGR
Ga0209798_1012349223300027843Wetland SedimentMSGLELLLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209166_1022912523300027857Surface SoilMSGVELVLAFLAGVAMGIALDRFVLPLLVDAWIDRLRRHER
Ga0209450_1009599853300027885Freshwater Lake SedimentMSEVELALAFLSGVVMGILLDRFVLPLLVDAWIDRLRRHGR
Ga0208980_1021994023300027887WetlandMSGVELVLAFFAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209777_1001456573300027896Freshwater Lake SedimentMSGVELALAFFSGVVLGILLDRWLLPPLVDAWIDRMRRHGR
Ga0209777_1002235723300027896Freshwater Lake SedimentMSEIELALAFLSGVVTGVLLDRWVLPPLVDLWIDRMRRHGQ
Ga0209777_1002920443300027896Freshwater Lake SedimentMSEVELALAFLSGVVTGVLLDRWVLPPLVDLWIDRMRRHGQ
Ga0209777_1004498873300027896Freshwater Lake SedimentMTGVELALAFLSGVVMGILLDRWLLPPLVDAWIDRLRRHGR
Ga0209777_1048960833300027896Freshwater Lake SedimentMSEIDLALAFLSGVVTGVLLDRFVLPLLVDAWIDRMRRHGQ
Ga0209777_1070556523300027896Freshwater Lake SedimentMSEVELGLAFRSGVVIGILLDRWLLPPLVDAWIARMRRHGR
Ga0209777_1071547013300027896Freshwater Lake SedimentMSEVELTLAFLSGVVMGTLLDRWLLPPLVDTWIDRMRRHGR
Ga0209254_1002040033300027897Freshwater Lake SedimentMSGVELVLAFLSGVAMGDALDRFVLPLLVDAWIDRLRRHGR
Ga0209254_1003235743300027897Freshwater Lake SedimentMSGVELALAFLSGVVMGMVLDRRLLPLLVDAWIDRMRRHGR
Ga0209254_1007157543300027897Freshwater Lake SedimentMSEVELGLAFLSGVGMGILLDRWVLPPLVDAWIDRMRRHGQ
Ga0209254_1009335263300027897Freshwater Lake SedimentMSGFELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209253_1028640223300027900Freshwater Lake SedimentMSGVELALAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209253_1034009323300027900Freshwater Lake SedimentMNGLELVLAFLGGVLMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0209048_1023341723300027902Freshwater Lake SedimentMSEVELALAFLSSVVMGMVLDRWLLPPLVDAWIDRMRRHGR
Ga0209048_1031800923300027902Freshwater Lake SedimentMSRVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHER
Ga0209048_1099945223300027902Freshwater Lake SedimentPRRQPRERSMSEVELGLAFRSGVVIGILLDRWLLPPLVDAWIARMRRHGR
Ga0307281_1005853223300028803SoilMTGIELVFALLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR
Ga0302291_1021182333300028865FenMSGIELVVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0302163_1003126033300028868FenMSEGELALAFLSGVVTGVVLDRWVLPPLVDAWVDRLRRA
Ga0299907_1022002323300030006SoilMSGVELILAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0302299_1012888613300030010FenLLAFLAGVVMGGALDRFVLPLLVDAWIERMRRHGR
Ga0302299_1029274213300030010FenMNGVELILAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0302286_1050466023300030047FenMNGLELVLALLAGVVMGGALDRWVLPPLADVWIDRMRRHGR
Ga0311333_1002375513300030114FenMNGLELVLALLAGVVMGGALDRWVLPPLADVWIDRM
Ga0311349_1071324113300030294FenMSLVELALAFLAGVAMGGALDRFVLPILVDAWIGRRRHGR
Ga0302046_1008731133300030620SoilMSGVELFLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0299913_1072085743300031229SoilMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRPRRHGR
Ga0302323_10071697923300031232FenMSLVELALAFLAGVVMGGALDRFVLPLLVDAWIERMRRHGR
Ga0302323_10261804323300031232FenMSGVELVLAFLAGVAMGGALDHFVRPLLVDAWIDRLRRHGR
Ga0302323_10305897333300031232FenPRRHPRGVPVSEMELVLAFLAGVVMGGALDRFVLPLVVDAWIDRLRRHGR
Ga0315556_1003532133300031256Salt Marsh SedimentVNGIELVVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0307418_100178313300031341Salt MarshVSGVELILAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHGR
Ga0272433_1002943163300031450RockMSGVELALAFLSGVVMGILLDRWVLPPLVDAWIDRLRRHGR
Ga0311364_1001943713300031521FenMNGLELVLALLAGVVMGGALDRWVLPPLADVWIDR
Ga0307380_1003631313300031539SoilMSGLELVAAFLSGIAMGIALDRWLLPSLVDAWIDRLRRHGR
Ga0307380_1030323813300031539SoilPVSGVELVLAFLAGMAMGIALDRWLLPSLVDAWIDRLHRHGR
Ga0307380_1030643963300031539SoilMSGVELVLAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHGQ
Ga0307380_1073930333300031539SoilMSGIELVLAFFAGVAMGIALDRWLLPSLVDAWIDRLRRHGR
Ga0307379_1002536753300031565SoilVSGVELVLAFLAGMAMGIALDRWLLPSLVDAWIDRLRRHGR
Ga0307379_1084381413300031565SoilMSGVELVAAFLSGIAMGIALDRWLLPSLVDAWIDRLRRHGR
Ga0307379_1153780723300031565SoilMNGVELILAFLAGVVMGIVLDRYVLPLLVDAWIDRLRRHGR
Ga0247727_1003844323300031576BiofilmVSGIELVVAFLAGVAMGIALDRWLLPPLVDAWIDRLPRHGR
Ga0315535_134433413300031699Salt Marsh SedimentPRRQLLRPPVSGVELILAFLAGVVMGGALDRFVLPLLVDAWIDQVRRHGR
Ga0315291_1148251933300031707SedimentRPRRQPCGPVSGVELVLAFLAGVVMGGALDRFLLPLLVDAWIDRLRRHGR
Ga0316576_1086218613300031727RhizosphereMNGLELVLAFLAGVAMGGALDRFVLPLLVDAWTDQVRRHGR
Ga0315293_1010293553300031746SedimentMSGVELTLAFLSGVVMGGALDRWLLPPLVDAWIDRLRRHGR
Ga0315293_1011102633300031746SedimentMSGVELILAFLVGVAMGIALDHFVLPLLVDAWIDRLRRHGR
Ga0315293_1064797643300031746SedimentRPRRQLSGGPMSGVELVLAFLGGVAAGIALDRWLLPPLVDAWIDRLRRHGR
Ga0315288_1008163873300031772SedimentMSGVELVLAFLGGVAAGIALDRWLLPPLVDAWIDRLRRHGR
Ga0315288_1009161563300031772SedimentMSGVELILAFLVGVAMGIALDRFVLPLLVDAWIDRLRRHGR
Ga0315290_1002111343300031834SedimentVSGVELALAFLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR
Ga0315290_1010773123300031834SedimentMSGIELVLAFLAFLAGVAMGIALDHWLLPPLADAWINRLRRHGR
Ga0315290_1011546233300031834SedimentMSGVELILAFLAGVVMGGALDRWVLPLLVDAWIDRLRRHGR
Ga0315290_1081043913300031834SedimentGRPMSGVELVLAFLAGVVMGGALDRFVLSLLVDAWIDRLRRHGR
Ga0315297_10000667123300031873SedimentMSGVELVLAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR
Ga0315297_1022414443300031873SedimentMNGLELVLAFLAGVVMGGALDRFVLPLLVDAWTDRLRRHGR
Ga0302322_10390532223300031902FenMSEVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0307407_1031359213300031903RhizosphereMSGVELVIAFLAGVVMGGALDRIVLPLLVDAWIDRTHRHGQ
Ga0311367_1049654543300031918FenPVSGIELALAFLAGVVMGGALDRFVLPLLVDAWIERLRRHGR
Ga0311367_1096352323300031918FenVSEVELALAFLAGVVMGGALDRFVLPLLVDACAGAPG
Ga0326597_1006212253300031965SoilMSGVELALAFLSGVAMGIVLDRWLLPPLVDAWIDRLRRHGR
Ga0326597_1115878823300031965SoilMSGVELILAFLAGVVMGGTLGRFVLPLLVDAWIDRLRRHGR
Ga0326597_1146267813300031965SoilMSGVELILAFLAGVVMGGALDRFVLPPLVDAWIDRLRRHGR
Ga0315278_1003654553300031997SedimentMSELELALAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315278_1004280463300031997SedimentMSEVELVAAFLAGVVMGGALDHFVLPLLVDAWIDRLRRHGR
Ga0315278_1005708993300031997SedimentMSGIELVLAFLAFLAFLAGVAMGIALDHWLLPPLADAWINRLRRHGR
Ga0315278_1016482023300031997SedimentMSGVELILAFLAGVVMGGALDRWLLLPLVDAWIDRLRRHGR
Ga0315278_1030123023300031997SedimentVSGVELVLAFLAGVVMGGALDRFLLPLLVDAWIDRLRRHGR
Ga0315278_1032351723300031997SedimentMSEVELALTFLSGVVTGILLDRFVLPPLVDAWIDRLRRLGQ
Ga0315278_1060346523300031997SedimentMSGVELVAAFLAGVAMGIALDRWLLPLLVDAWIDRLRRHGR
Ga0315278_1097176113300031997SedimentMSGVELVLAFLAGVIMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315278_1130738633300031997SedimentMSGVELVAAFLAGVLMGGALDHFVLPLVVDAWIDRLRRHGR
Ga0315278_1132313713300031997SedimentMTGVELVLAFLAGVAMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315278_1136123623300031997SedimentVSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315278_1150404723300031997SedimentMSGVDLVVAFLAGVAMGIALDRFELPLLVDPWIDRLRRHGR
Ga0315278_1150547413300031997SedimentMSDVDLVLAFLSGVVMGILLDRWLLPLLVDAWIDRLRRHGR
Ga0315278_1198831023300031997SedimentMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRMRRHGR
Ga0315272_1009598413300032018SedimentMSGLELVAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315272_1056879423300032018SedimentMTGIELALAFLWGVAMGVALDRWVLPPLVDVWVGRPRRHGR
Ga0315272_1058495413300032018SedimentMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIGRRRHGR
Ga0315540_1003037833300032061Salt Marsh SedimentMSGFELVLAFLAGVIMGGALDRFVLPLLVDAWIDQVRRHGR
Ga0315540_1022188923300032061Salt Marsh SedimentVSGIELVLAFLAGVVMGGALDRFVLPLLVDVWIDQVRRHGR
Ga0315292_1036018643300032143SedimentMNGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315292_1039508033300032143SedimentMSEVELVAAFLASVIMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315292_1042678233300032143SedimentMSGIELVLAFLAGVAMGIALDHWLLPPLADAWINRLRRHGR
Ga0315292_1100537123300032143SedimentMSGVELVLAFLAGVVMGGALDRFVLSLLVDAWIDRLRRHGR
Ga0315295_1031185413300032156SedimentSGVELVLAFLGGVAAGIALDRWLLPPLVDAWIDRLRRHGR
Ga0315281_1035967213300032163SedimentVSGVELVLAFLAGVGMGILLDRWLLPSLVDAWIDQLRRHGQ
Ga0315281_1045386723300032163SedimentMSGVELVVAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR
Ga0315281_1216424113300032163SedimentMNGIELAVAFLAGVAMGIALDRFVLPMLVDAWIDRLRRHGR
Ga0315283_1097465733300032164SedimentMSGVELVLAFLAGVVMGGALDRFVLPPLVDAWIDRLRRHGR
Ga0315283_1102283913300032164SedimentVSEVELVLAFLAGVVMGILLDRWVLPPLVDLGIDRMRRHGR
Ga0315283_1148399823300032164SedimentMSGIELVAAFLAGVAMGIALDRWLLPSLVDAWIDRLRRHGQ
Ga0315283_1204488433300032164SedimentPRDGSMSEIELALAFLSGVVMGILLDRWLLPPLVDAWIDRMRRHGR
Ga0315268_1000945283300032173SedimentMSGVELILAFLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR
Ga0315268_1044138023300032173SedimentMSGVELVLTFLAGVVMGGALDRFVLPLLVDAWIDLLRRHGR
Ga0315268_1177175323300032173SedimentMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRNGR
Ga0315271_1014383423300032256SedimentMSGVELVLAFLAGVAMGIALDRWLLPPIVDAWIARMRRHGR
Ga0315271_1063623013300032256SedimentVSGVELVLAFLAGVLPGGALDRFQLPLLVDAWIDRLRRHRR
Ga0315271_1073233833300032256SedimentRRQQRGSPMSGLELVLAFLSGVAMGILLDRWLLPTLVDAWIDRMRRHGR
Ga0315271_1108301413300032256SedimentQPHEGSMSGVELVAAFLAGVAMGIALDRWLLPLLVDAWIDRLRRHGR
Ga0315270_1040913723300032275SedimentMSGVELVLAFLGGVAAGIALDRWLLPPLVDAWIDRMHRHGR
Ga0315270_1049711513300032275SedimentMSGVELALAFLSGVVTGVLLDRWVLPPLVDLWIARMRRHGR
Ga0315270_1076565623300032275SedimentMSGVELVLAFLAGVAMGIALDRWLLPPLVDAWIDRLRRHGR
Ga0315270_1092743613300032275SedimentMSGVELALAFLSGVVMGGALDRFVLPFLVDAWIDR
Ga0315270_1106232213300032275SedimentRPRRHPGGGAMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIGRRRHGR
Ga0315286_1042248713300032342SedimentLALAFLSGVVIGILLDRSLLPPLVDAWIDRMRRPGR
Ga0315286_1218040813300032342SedimentGSMSEVELALAFLSGVATGVLLDRWVFPPLVDLWIDRMRRHGQ
Ga0315287_1017905113300032397SedimentMSGAELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315287_1064806943300032397SedimentMSEVELILAFLVGVAMGIALDRWLLPPLVDAWIDRLRRHGR
Ga0315287_1069502523300032397SedimentMSGIELVLAFLAGVVMGGALDRFVLPLLVDAWIGRLRRHGH
Ga0315287_1122103613300032397SedimentELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315287_1249502323300032397SedimentMSGVELVLAFLAGVIMGGALDRFVLPLLVDAWIARLRRHGR
Ga0315287_1273937333300032397SedimentMSGVELILAFLAGVIMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315275_1215492313300032401SedimentPRRHLPGGPMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0315273_1153521013300032516SedimentMSEIDLVLAFLSGVVTSVLLDRWLLPPLVDAWIDRMHRHGR
Ga0315273_1214860723300032516SedimentMSGVELVLAFLAGVVMGGALDRFMLPLLVDAWIDQLRRHGR
Ga0334722_10004801163300033233SedimentMSEVELALAFLAGVVMGVLLDRFVLPLLVDAWIDRLRRHGR
Ga0334722_1002170543300033233SedimentMSGIELALAFSSGVVMGIALDRWLLPPLVDAWIDRLRRHGR
Ga0334722_1010283253300033233SedimentMSGVELVLAFLAGVAMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0334722_1035803113300033233SedimentALAFLAGVVMGGALDRFLLPLLVDAWIDRLRRHGR
Ga0316603_1115629523300033413SoilMSGVELVLAFLAGVVIGGALDRFVLPLLVDAWIDRLRRYGR
Ga0316616_10188634623300033521SoilMSGVELIAAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0334811_101013_267_3923300033891SoilMSEVDLALAFLAGVVMGILLDRWVLPPLVDAWIDRLRRHGQ
Ga0373890_026684_508_6333300034053Sediment SlurryMSGLDLIVAFLAGVVMGGALDFFVLPLLVDAWIDRLHRHGR
Ga0373891_078988_128_2533300034054Sediment SlurryMSGLDLIVAFLAGVVMGGALDRFVLPLLVDAWIDRLRRHGR
Ga0373899_006193_975_10793300034077Sediment SlurryMSGVELVLAFLAGVVMGGALDRFVLPLLVDAWIDR
Ga0373899_008525_54_1793300034077Sediment SlurryMSGLDLIVAFLAGVVMGGALDRFVLPILVDAWIDRLRRHGR
Ga0370484_0012161_2_1063300034125Untreated Peat SoilMSGVELVAAFLAGVVMGGALDRFVLPLLVDAWIDR
Ga0364942_0102450_421_5463300034165SedimentMSGVELILAFFAGVAMGIALDRWLLPSLVDAWIDRLRRHGR
Ga0370481_0005631_2069_21913300034281Untreated Peat SoilMSEVELTLAFLAGVVMGGALDRFVTPLLVDAWIGRCRDGQ
Ga0364936_073437_7_1323300034773SedimentMNGVELALAFSSGVAMGIGLDRWLLPVLVDAWIDRLRRHER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.