Basic Information | |
---|---|
Family ID | F047387 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 150 |
Average Sequence Length | 42 residues |
Representative Sequence | MAAEVAREILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 150 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 84.67 % |
% of genes near scaffold ends (potentially truncated) | 18.67 % |
% of genes from short scaffolds (< 2000 bps) | 70.00 % |
Associated GOLD sequencing projects | 104 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.47 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (86.667 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (15.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.667 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (34.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 150 Family Scaffolds |
---|---|---|
PF05016 | ParE_toxin | 20.67 |
PF01243 | Putative_PNPOx | 2.67 |
PF02805 | Ada_Zn_binding | 1.33 |
PF00491 | Arginase | 1.33 |
PF03050 | DDE_Tnp_IS66 | 1.33 |
PF13614 | AAA_31 | 1.33 |
PF04014 | MazE_antitoxin | 1.33 |
PF11842 | DUF3362 | 0.67 |
PF01844 | HNH | 0.67 |
PF03288 | Pox_D5 | 0.67 |
PF06973 | DUF1297 | 0.67 |
PF02787 | CPSase_L_D3 | 0.67 |
PF13424 | TPR_12 | 0.67 |
PF08352 | oligo_HPY | 0.67 |
PF13649 | Methyltransf_25 | 0.67 |
PF04463 | 2-thiour_desulf | 0.67 |
PF02786 | CPSase_L_D2 | 0.67 |
PF01986 | DUF123 | 0.67 |
PF01139 | RtcB | 0.67 |
PF09924 | LPG_synthase_C | 0.67 |
PF11950 | DUF3467 | 0.67 |
PF03400 | DDE_Tnp_IS1 | 0.67 |
PF17200 | sCache_2 | 0.67 |
PF13412 | HTH_24 | 0.67 |
PF04862 | DUF642 | 0.67 |
PF04019 | DUF359 | 0.67 |
PF00730 | HhH-GPD | 0.67 |
PF02604 | PhdYeFM_antitox | 0.67 |
PF13847 | Methyltransf_31 | 0.67 |
PF14698 | ASL_C2 | 0.67 |
PF13392 | HNH_3 | 0.67 |
PF07694 | 5TM-5TMR_LYT | 0.67 |
PF13414 | TPR_11 | 0.67 |
PF02525 | Flavodoxin_2 | 0.67 |
PF01656 | CbiA | 0.67 |
PF02540 | NAD_synthase | 0.67 |
PF12706 | Lactamase_B_2 | 0.67 |
PF02142 | MGS | 0.67 |
PF00128 | Alpha-amylase | 0.67 |
PF00528 | BPD_transp_1 | 0.67 |
COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
---|---|---|---|
COG3436 | Transposase | Mobilome: prophages, transposons [X] | 1.33 |
COG2169 | Methylphosphotriester-DNA--protein-cysteine methyltransferase (N-terminal fragment of Ada), contains Zn-binding and two AraC-type DNA-binding domains | Replication, recombination and repair [L] | 1.33 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 1.33 |
COG1690 | RNA-splicing ligase RtcB, repairs tRNA damage | Translation, ribosomal structure and biogenesis [J] | 0.67 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.67 |
COG3378 | DNA primase, phage- or plasmid-associated | Mobilome: prophages, transposons [X] | 0.67 |
COG3280 | Maltooligosyltrehalose synthase | Carbohydrate transport and metabolism [G] | 0.67 |
COG3275 | Sensor histidine kinase, LytS/YehU family | Signal transduction mechanisms [T] | 0.67 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.67 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.67 |
COG1909 | Archaeal dephospho-CoA kinase | Coenzyme transport and metabolism [H] | 0.67 |
COG1833 | Uri superfamily endonuclease | General function prediction only [R] | 0.67 |
COG1683 | Uncharacterized conserved protein YbbK, DUF523 family | Function unknown [S] | 0.67 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.67 |
COG1523 | Pullulanase/glycogen debranching enzyme | Carbohydrate transport and metabolism [G] | 0.67 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.67 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.67 |
COG0366 | Glycosidase/amylase (phosphorylase) | Carbohydrate transport and metabolism [G] | 0.67 |
COG0296 | 1,4-alpha-glucan branching enzyme | Carbohydrate transport and metabolism [G] | 0.67 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.67 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.67 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.67 % |
Unclassified | root | N/A | 9.33 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908028|beta3_all_NODE_65973_len_898_cov_11_523385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → unclassified Syntrophorhabdus → Syntrophorhabdus sp. PtaB.Bin027 | 948 | Open in IMG/M |
3300000032|Draft_c0056151 | All Organisms → cellular organisms → Archaea | 716 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102758499 | All Organisms → cellular organisms → Archaea | 545 | Open in IMG/M |
3300001213|JGIcombinedJ13530_105959688 | All Organisms → cellular organisms → Archaea | 609 | Open in IMG/M |
3300001410|JGI20179J14886_1000232 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 4273 | Open in IMG/M |
3300001410|JGI20179J14886_1000831 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2538 | Open in IMG/M |
3300002069|JGIcombinedJ21912_10201815 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 667 | Open in IMG/M |
3300002072|JGIcombinedJ21914_10193755 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → unclassified Syntrophorhabdus → Syntrophorhabdus sp. PtaB.Bin027 | 560 | Open in IMG/M |
3300002220|MLSBCLC_10136598 | All Organisms → cellular organisms → Archaea | 694 | Open in IMG/M |
3300002703|draft_10895699 | All Organisms → cellular organisms → Archaea | 617 | Open in IMG/M |
3300002961|JGI11641J44799_10016486 | All Organisms → cellular organisms → Archaea | 2215 | Open in IMG/M |
3300003432|JGI20214J51088_10071343 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 2430 | Open in IMG/M |
3300003541|JGI20214J51650_10200867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Thiotrichales → Thiotrichaceae → Beggiatoa → unclassified Beggiatoa → Beggiatoa sp. 4572_84 | 1375 | Open in IMG/M |
3300005259|Ga0071344_1021429 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 12068 | Open in IMG/M |
3300005259|Ga0071344_1024480 | Not Available | 1035 | Open in IMG/M |
3300005259|Ga0071344_1035398 | Not Available | 9319 | Open in IMG/M |
3300005263|Ga0071346_1014952 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 3947 | Open in IMG/M |
3300005323|Ga0074198_1015715 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1935 | Open in IMG/M |
3300005325|Ga0074199_1000926 | All Organisms → cellular organisms → Archaea | 33396 | Open in IMG/M |
3300005326|Ga0074195_1001939 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 25677 | Open in IMG/M |
3300005645|Ga0077109_1110587 | All Organisms → cellular organisms → Archaea | 732 | Open in IMG/M |
3300006092|Ga0082021_1202984 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 4186 | Open in IMG/M |
3300006398|Ga0079067_1002794 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1080 | Open in IMG/M |
3300006434|Ga0100130_119221 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 550 | Open in IMG/M |
3300006597|Ga0079070_1268920 | All Organisms → cellular organisms → Archaea | 562 | Open in IMG/M |
3300006642|Ga0075521_10430695 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 643 | Open in IMG/M |
3300006650|Ga0101722_105220 | All Organisms → cellular organisms → Archaea | 1451 | Open in IMG/M |
3300006651|Ga0101725_116763 | All Organisms → cellular organisms → Archaea | 738 | Open in IMG/M |
3300006667|Ga0101751_107788 | All Organisms → cellular organisms → Archaea | 1062 | Open in IMG/M |
3300006671|Ga0101734_128368 | All Organisms → cellular organisms → Archaea | 648 | Open in IMG/M |
3300006838|Ga0101938_1036667 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300006883|Ga0102488_115342 | All Organisms → cellular organisms → Archaea | 588 | Open in IMG/M |
3300006930|Ga0079303_10063774 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1329 | Open in IMG/M |
3300006930|Ga0079303_10167989 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 866 | Open in IMG/M |
3300006930|Ga0079303_10462594 | Not Available | 544 | Open in IMG/M |
3300008805|Ga0115940_1008966 | All Organisms → cellular organisms → Archaea | 1046 | Open in IMG/M |
3300009081|Ga0105098_10351842 | All Organisms → cellular organisms → Archaea | 720 | Open in IMG/M |
3300009081|Ga0105098_10396544 | All Organisms → cellular organisms → Archaea | 684 | Open in IMG/M |
3300009082|Ga0105099_10726217 | All Organisms → cellular organisms → Archaea | 617 | Open in IMG/M |
3300009085|Ga0105103_10156306 | All Organisms → cellular organisms → Archaea | 1206 | Open in IMG/M |
3300009085|Ga0105103_10884455 | All Organisms → cellular organisms → Archaea | 523 | Open in IMG/M |
3300009091|Ga0102851_10439767 | All Organisms → cellular organisms → Archaea | 1324 | Open in IMG/M |
3300009091|Ga0102851_13268746 | All Organisms → cellular organisms → Archaea | 521 | Open in IMG/M |
3300009111|Ga0115026_10450244 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 945 | Open in IMG/M |
3300009111|Ga0115026_10562525 | All Organisms → cellular organisms → Archaea | 859 | Open in IMG/M |
3300009131|Ga0115027_10292958 | All Organisms → cellular organisms → Archaea | 1090 | Open in IMG/M |
3300009131|Ga0115027_10664085 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 777 | Open in IMG/M |
3300009131|Ga0115027_10932507 | All Organisms → cellular organisms → Archaea | 674 | Open in IMG/M |
3300009131|Ga0115027_11750573 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 519 | Open in IMG/M |
3300009146|Ga0105091_10158307 | All Organisms → cellular organisms → Archaea | 1064 | Open in IMG/M |
3300009165|Ga0105102_10625665 | All Organisms → cellular organisms → Archaea | 597 | Open in IMG/M |
3300009168|Ga0105104_10055769 | All Organisms → cellular organisms → Archaea | 2146 | Open in IMG/M |
3300009168|Ga0105104_10394453 | All Organisms → cellular organisms → Archaea | 769 | Open in IMG/M |
3300009179|Ga0115028_10522701 | All Organisms → cellular organisms → Archaea | 868 | Open in IMG/M |
3300009179|Ga0115028_11425917 | All Organisms → cellular organisms → Archaea | 584 | Open in IMG/M |
3300009388|Ga0103809_1000137 | Not Available | 43467 | Open in IMG/M |
3300009566|Ga0130025_1138258 | All Organisms → cellular organisms → Archaea | 2735 | Open in IMG/M |
3300009666|Ga0116182_1173346 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 985 | Open in IMG/M |
3300009674|Ga0116173_1085859 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1649 | Open in IMG/M |
3300009692|Ga0116171_10268649 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 939 | Open in IMG/M |
3300009693|Ga0116141_10458631 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 647 | Open in IMG/M |
3300009696|Ga0116177_10365898 | All Organisms → cellular organisms → Archaea | 763 | Open in IMG/M |
3300010319|Ga0136653_10018225 | All Organisms → cellular organisms → Archaea | 3693 | Open in IMG/M |
3300010351|Ga0116248_10196559 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 1656 | Open in IMG/M |
3300010351|Ga0116248_10519902 | All Organisms → cellular organisms → Archaea | 870 | Open in IMG/M |
3300010352|Ga0116247_10974056 | All Organisms → cellular organisms → Archaea | 620 | Open in IMG/M |
3300010353|Ga0116236_10050755 | All Organisms → cellular organisms → Archaea | 4417 | Open in IMG/M |
3300010365|Ga0116251_10358923 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 812 | Open in IMG/M |
3300013090|Ga0163209_1179372 | All Organisms → cellular organisms → Archaea | 727 | Open in IMG/M |
3300014490|Ga0182010_10061696 | All Organisms → cellular organisms → Archaea | 1809 | Open in IMG/M |
3300014490|Ga0182010_10099390 | All Organisms → cellular organisms → Archaea | 1455 | Open in IMG/M |
3300014490|Ga0182010_10272806 | All Organisms → cellular organisms → Archaea | 903 | Open in IMG/M |
3300014494|Ga0182017_10358411 | All Organisms → cellular organisms → Archaea | 907 | Open in IMG/M |
3300014496|Ga0182011_10001012 | All Organisms → cellular organisms → Archaea | 24569 | Open in IMG/M |
3300014502|Ga0182021_10194584 | Not Available | 2367 | Open in IMG/M |
3300014502|Ga0182021_10202322 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2320 | Open in IMG/M |
3300014502|Ga0182021_10385306 | All Organisms → cellular organisms → Archaea | 1661 | Open in IMG/M |
3300014502|Ga0182021_10479414 | All Organisms → cellular organisms → Archaea | 1482 | Open in IMG/M |
3300014502|Ga0182021_12194841 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 665 | Open in IMG/M |
3300017988|Ga0181520_10006616 | Not Available | 17602 | Open in IMG/M |
3300018018|Ga0187886_1177578 | All Organisms → cellular organisms → Archaea | 832 | Open in IMG/M |
3300019224|Ga0180029_1216525 | Not Available | 2264 | Open in IMG/M |
3300019225|Ga0179949_1000926 | All Organisms → cellular organisms → Archaea | 616 | Open in IMG/M |
3300019236|Ga0179944_1130894 | All Organisms → cellular organisms → Archaea | 822 | Open in IMG/M |
3300019788|Ga0182028_1162862 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1410 | Open in IMG/M |
3300020048|Ga0207193_1000187 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 110440 | Open in IMG/M |
3300020163|Ga0194039_1026306 | All Organisms → cellular organisms → Archaea | 2282 | Open in IMG/M |
3300020814|Ga0214088_1150823 | All Organisms → cellular organisms → Archaea | 3799 | Open in IMG/M |
3300022556|Ga0212121_10099564 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 2216 | Open in IMG/M |
3300022556|Ga0212121_10475865 | Not Available | 804 | Open in IMG/M |
3300022650|Ga0236339_1209818 | All Organisms → cellular organisms → Archaea | 705 | Open in IMG/M |
3300023207|Ga0255811_10330981 | All Organisms → cellular organisms → Archaea | 3586 | Open in IMG/M |
3300024233|Ga0224521_1096853 | All Organisms → cellular organisms → Archaea | 637 | Open in IMG/M |
3300025533|Ga0208584_1006976 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2947 | Open in IMG/M |
3300025600|Ga0209125_1137334 | All Organisms → cellular organisms → Archaea | 566 | Open in IMG/M |
3300025692|Ga0209744_1115352 | All Organisms → cellular organisms → Archaea | 906 | Open in IMG/M |
3300025706|Ga0209507_1017352 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 2830 | Open in IMG/M |
3300025706|Ga0209507_1038805 | All Organisms → cellular organisms → Archaea | 1540 | Open in IMG/M |
3300025714|Ga0208458_1050746 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1645 | Open in IMG/M |
3300025720|Ga0208197_1012446 | Not Available | 4642 | Open in IMG/M |
3300025730|Ga0209606_1026527 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 3054 | Open in IMG/M |
3300025748|Ga0208459_1241806 | All Organisms → cellular organisms → Archaea | 591 | Open in IMG/M |
3300025764|Ga0209539_1048110 | Not Available | 1842 | Open in IMG/M |
3300025836|Ga0209748_1000935 | Not Available | 14762 | Open in IMG/M |
3300025852|Ga0209124_10329810 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → unclassified Syntrophorhabdus → Syntrophorhabdus sp. PtaB.Bin027 | 568 | Open in IMG/M |
3300025858|Ga0209099_1100952 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1256 | Open in IMG/M |
3300025867|Ga0209098_1051180 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 2097 | Open in IMG/M |
3300025867|Ga0209098_1296174 | All Organisms → cellular organisms → Archaea | 624 | Open in IMG/M |
3300027419|Ga0209340_1019162 | All Organisms → cellular organisms → Archaea | 2078 | Open in IMG/M |
3300027675|Ga0209077_1165078 | All Organisms → cellular organisms → Archaea | 618 | Open in IMG/M |
3300027693|Ga0209704_1003673 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 3354 | Open in IMG/M |
3300027887|Ga0208980_10043123 | All Organisms → cellular organisms → Archaea | 2629 | Open in IMG/M |
3300027887|Ga0208980_10411126 | All Organisms → cellular organisms → Archaea | 780 | Open in IMG/M |
3300027890|Ga0209496_10646052 | All Organisms → cellular organisms → Archaea | 575 | Open in IMG/M |
3300027896|Ga0209777_10222567 | All Organisms → cellular organisms → Archaea | 1501 | Open in IMG/M |
3300027896|Ga0209777_10240601 | All Organisms → cellular organisms → Archaea | 1429 | Open in IMG/M |
3300027899|Ga0209668_10909482 | All Organisms → cellular organisms → Archaea | 593 | Open in IMG/M |
3300027956|Ga0209820_1214798 | All Organisms → cellular organisms → Archaea | 537 | Open in IMG/M |
3300027958|Ga0209749_1000857 | All Organisms → cellular organisms → Archaea | 34113 | Open in IMG/M |
3300027958|Ga0209749_1202877 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 528 | Open in IMG/M |
3300028156|Ga0268281_1000130 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 57502 | Open in IMG/M |
3300028169|Ga0268279_1100013 | Not Available | 789 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10001373 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 47944 | Open in IMG/M |
3300028664|Ga0302164_10036357 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 1319 | Open in IMG/M |
3300029252|Ga0167179_1000484 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii | 24164 | Open in IMG/M |
3300029288|Ga0265297_10875823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. SC_K08D17 | 543 | Open in IMG/M |
3300029799|Ga0311022_12385263 | All Organisms → cellular organisms → Archaea | 555 | Open in IMG/M |
3300030114|Ga0311333_10726192 | All Organisms → cellular organisms → Archaea | 830 | Open in IMG/M |
3300031232|Ga0302323_101350947 | All Organisms → cellular organisms → Archaea | 800 | Open in IMG/M |
3300031707|Ga0315291_10126205 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 2717 | Open in IMG/M |
3300031707|Ga0315291_10653326 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 943 | Open in IMG/M |
3300031746|Ga0315293_10093155 | All Organisms → cellular organisms → Archaea | 2565 | Open in IMG/M |
3300031772|Ga0315288_10097916 | Not Available | 3359 | Open in IMG/M |
3300032069|Ga0315282_10080089 | All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon | 3105 | Open in IMG/M |
3300032069|Ga0315282_10136763 | All Organisms → cellular organisms → Archaea | 1988 | Open in IMG/M |
3300032143|Ga0315292_10138676 | All Organisms → cellular organisms → Archaea | 1943 | Open in IMG/M |
3300032143|Ga0315292_10298163 | All Organisms → cellular organisms → Archaea | 1341 | Open in IMG/M |
3300032156|Ga0315295_10672842 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix | 1046 | Open in IMG/M |
3300032163|Ga0315281_12086959 | All Organisms → cellular organisms → Archaea | 539 | Open in IMG/M |
3300032177|Ga0315276_11432185 | All Organisms → cellular organisms → Archaea | 721 | Open in IMG/M |
3300032342|Ga0315286_10144512 | All Organisms → cellular organisms → Archaea | 2553 | Open in IMG/M |
3300032397|Ga0315287_11037793 | All Organisms → cellular organisms → Archaea | 953 | Open in IMG/M |
3300032828|Ga0335080_12277453 | Not Available | 519 | Open in IMG/M |
3300033408|Ga0316605_11219455 | All Organisms → cellular organisms → Archaea | 727 | Open in IMG/M |
3300033414|Ga0316619_10623973 | All Organisms → cellular organisms → Archaea | 900 | Open in IMG/M |
3300033419|Ga0316601_100548191 | All Organisms → cellular organisms → Archaea | 1117 | Open in IMG/M |
3300033820|Ga0334817_031039 | All Organisms → cellular organisms → Archaea | 1080 | Open in IMG/M |
3300034070|Ga0334822_043797 | All Organisms → cellular organisms → Archaea | 980 | Open in IMG/M |
3300034169|Ga0370480_0005744 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 4490 | Open in IMG/M |
3300034169|Ga0370480_0019152 | All Organisms → cellular organisms → Archaea | 2393 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 15.33% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.67% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 8.00% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 7.33% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 7.33% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 6.00% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 4.67% |
Sediment | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment | 4.67% |
Bioremediated Contaminated Groundwater | Engineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater | 4.00% |
Anaerobic Enrichment Culture | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture | 2.67% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.67% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.00% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 2.00% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.00% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 2.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.00% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.33% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.33% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.33% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.33% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.33% |
Anaerobic Digester Digestate | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate | 1.33% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.67% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.67% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.67% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.67% |
Brackish Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Brackish Water | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.67% |
Sediment | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Sediment | 0.67% |
Aquifer Solids | Environmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Aquifer Solids | 0.67% |
Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.67% |
Wastewater Treatment Plant | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater Treatment Plant | 0.67% |
Biosolids | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Biosolids | 0.67% |
Hydrocarbon Resource Environments | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments | 0.67% |
Enrichment Culture | Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture | 0.67% |
Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 0.67% |
Granular Sludge | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908028 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3 | Environmental | Open in IMG/M |
3300000032 | Oil sands microbial community from Northern Alberta which degrade Naphthaline | Engineered | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001410 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 | Environmental | Open in IMG/M |
3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002072 | Barrow Graham LP Ref core NGADG0011-211 (Barrow Graham LP Ref core NGADG0011-211,NGADG0004-312, ASSEMBLY_DATE=20131005) | Environmental | Open in IMG/M |
3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300002703 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5 | Engineered | Open in IMG/M |
3300002961 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300005259 | Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid and Glucose under anaerobic conditions - HA Sample 1 | Environmental | Open in IMG/M |
3300005263 | Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3 | Environmental | Open in IMG/M |
3300005323 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-23 | Engineered | Open in IMG/M |
3300005325 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 | Engineered | Open in IMG/M |
3300005326 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23 | Engineered | Open in IMG/M |
3300005645 | Brackish water microbial communities from Lake Sakinaw in Canada: eDNA_2 (120m) | Environmental | Open in IMG/M |
3300006092 | Activated sludge microbial communities from wastewater treatment plant in Ulu Pandan, Singapore | Engineered | Open in IMG/M |
3300006398 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006434 | T18 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
3300006597 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006650 | T5 (1) (Live) Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
3300006651 | T8 (1) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
3300006667 | T8 (1) BES Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
3300006671 | T10 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
3300006838 | Combined Assembly of Gp0125106, Gp0125107, Gp0125108 | Environmental | Open in IMG/M |
3300006883 | T10 (1) BES, Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times | Environmental | Open in IMG/M |
3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
3300008805 | T5 (1) (Live) Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009388 | Metatranscriptome sequencing of an Anaerobic Hexadecane-Degrading Microbial Consortia from University of California, San Diego, USA - Hexadecane | Engineered | Open in IMG/M |
3300009566 | Methanogenic o-xylene degrading microbial communities from aquifer solids in Pensacola, Florida - enrichment culture X8-AB | Environmental | Open in IMG/M |
3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
3300009674 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG | Engineered | Open in IMG/M |
3300009692 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG | Engineered | Open in IMG/M |
3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
3300010319 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG | Environmental | Open in IMG/M |
3300010351 | AD_USPNca | Engineered | Open in IMG/M |
3300010352 | AD_JPHWca | Engineered | Open in IMG/M |
3300010353 | AD_USCAca | Engineered | Open in IMG/M |
3300010365 | AD_USDIca | Engineered | Open in IMG/M |
3300013090 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_160m | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300019224 | Anaerobic biogas reactor microbial communites from Seattle, Washington, USA - Biogas_R1-B RNA time zero (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019225 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW1_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019236 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC10_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020163 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8m | Environmental | Open in IMG/M |
3300020814 | Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahit | Engineered | Open in IMG/M |
3300022556 | Kivu_combined assembly | Environmental | Open in IMG/M |
3300022650 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3 | Environmental | Open in IMG/M |
3300023207 | Combined Assembly of Gp0238866, Gp0238878, Gp0238879 | Engineered | Open in IMG/M |
3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025600 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A (SPAdes) | Environmental | Open in IMG/M |
3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025720 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA4_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025748 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025764 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes) | Environmental | Open in IMG/M |
3300025836 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 004-21A (SPAdes) | Environmental | Open in IMG/M |
3300025852 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A (SPAdes) | Environmental | Open in IMG/M |
3300025858 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025867 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300027419 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-23 (SPAdes) | Engineered | Open in IMG/M |
3300027675 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027958 | Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample SAE3-47 (SPAdes) | Engineered | Open in IMG/M |
3300028156 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_5_24_50m | Environmental | Open in IMG/M |
3300028169 | Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80m | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300028664 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_1 | Environmental | Open in IMG/M |
3300029252 | Biosolids microbial communities from sewage treatment plant in Sweden - SWESTP26 - Henriksdal-digested 138 | Engineered | Open in IMG/M |
3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
3300029799 | Metagenomes from anaerobic digester of solid waste, Toronto, Canda. Combined Assembly of Gp0238878, Gp0238879, Gp0242100, Gp0242119 | Engineered | Open in IMG/M |
3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033820 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-D | Environmental | Open in IMG/M |
3300034070 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-M | Environmental | Open in IMG/M |
3300034169 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_15 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
beta3_all_01262090 | 2124908028 | Soil | MAAEVAREVLTKEEDYADAEYRRFLKEKDKYMDFDEFCRQEGI |
Draft_00561512 | 3300000032 | Hydrocarbon Resource Environments | MAAQVAREILNDEEYADAEYQRFLKEKDKYVDFDEFCRKEEI* |
JGIcombinedJ13530_1027584992 | 3300001213 | Wetland | MAAEVAREVLTKDEEYADSEYRRFLKEKNKYMDFDEFCRQEGI* |
JGIcombinedJ13530_1059596883 | 3300001213 | Wetland | MAAEVVREVLTKEEEYADAEYRRFLREKDKYVDFDDFCRREGI* |
JGI20179J14886_10002325 | 3300001410 | Arctic Peat Soil | MGYRGLNMAAEVAREVLTKEEDYADAEYRRFLKEKDKYMDFDEFCRQEGI* |
JGI20179J14886_10008316 | 3300001410 | Arctic Peat Soil | MAPEELLTKDYADAEYRRFLKEKDKYMDFDEFCRQEEI* |
JGIcombinedJ21912_102018153 | 3300002069 | Arctic Peat Soil | MAPEELLTKDYADAEYRRFLKEKDKYMDFDEFCRQE |
JGIcombinedJ21914_101937551 | 3300002072 | Arctic Peat Soil | AEVAREVLTKEEDYADAEYRRFLKEKDKYMDFDEFCRQEGI* |
MLSBCLC_101365982 | 3300002220 | Hydrocarbon Resource Environments | MAAEIAREILTKEEEYADAEYRRFLKEKTKYVDFDEFCRQEGI* |
draft_108956991 | 3300002703 | Hydrocarbon Resource Environments | MAAEIANKVLNDEEYADAEYRRFLKEKDKYMDFDEFCRKEGI* |
JGI11641J44799_100164864 | 3300002961 | Wetland | MAAEIAREVLTEEEQYADAEYRRFLKDKDKYKDFDEFCHEQGI* |
JGI20214J51088_100713432 | 3300003432 | Wetland | MAAEIASEVLTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
JGI20214J51650_102008671 | 3300003541 | Wetland | MAAEIANQVLADEEYADAEYRRFLKEKDKYTDFDEFCRKEGI* |
Ga0071344_102142918 | 3300005259 | Anaerobic Enrichment Culture | MAAEIAGEILTDEEYADAEYRRFLREKDKYVDFYEFCRQEGI* |
Ga0071344_10244802 | 3300005259 | Anaerobic Enrichment Culture | MAAEIASETLTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0071344_10353983 | 3300005259 | Anaerobic Enrichment Culture | MAAEVSREILTDEEYADAEYRRLLKEKDQYMDFDEFCREEGI* |
Ga0071346_10149523 | 3300005263 | Anaerobic Enrichment Culture | MAAEITNEILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0074198_10157152 | 3300005323 | Bioremediated Contaminated Groundwater | MAAEVAREVLTTKEEEYADAEYRRFLKEKDKYADFDEFCREEGI* |
Ga0074199_100092619 | 3300005325 | Bioremediated Contaminated Groundwater | MAAEIASEILTDEEYADAEYRRFLREKDKYADFDEFCRQEGI* |
Ga0074195_100193928 | 3300005326 | Bioremediated Contaminated Groundwater | MAAEIAREILTDEEYADAEYRRLLREKDKYMDFDEFCREEGI* |
Ga0077109_11105872 | 3300005645 | Brackish Water | MAAEVAIEVLSDEEEYADAEYRRFLREKDKYVDFDDFCRQEGI* |
Ga0082021_12029843 | 3300006092 | Wastewater Treatment Plant | MASEIAREVLTDEEYADAEYRRFLKEKDKYMDFDEFCREEGI* |
Ga0079067_10027941 | 3300006398 | Anaerobic Digestor Sludge | QVVRKILTDEEYADAEYRRFLKEKDKYVDFDEFCRKEGI* |
Ga0100130_1192212 | 3300006434 | Sediment | MYAIDILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0079070_12689202 | 3300006597 | Anaerobic Digestor Sludge | MAAEIASEVLTDEEYADAEHRRFLKEKDKYTDFDEFCRKEGF* |
Ga0075521_104306952 | 3300006642 | Arctic Peat Soil | MAAEVAREVFTNEEEYADAEYKRFLKEKDKYMDFDEFCRQEGI* |
Ga0101722_1052203 | 3300006650 | Sediment | MHAIDILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0101725_1167632 | 3300006651 | Sediment | MAAEISREVIILDEEYADAEYRRFLREEDKYMDFDEFCCQEGI* |
Ga0101751_1077881 | 3300006667 | Sediment | ELNMAAEIANEVLTDEEYADAEYRRLLKEKDKYMDFDEFCREEGI* |
Ga0101734_1283682 | 3300006671 | Sediment | MHAIDIITDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0101938_10366671 | 3300006838 | Sediment | MAAEVSREILTDEEYADAEYRRLLKEKYQYVDFDEFCREEGI* |
Ga0102488_1153422 | 3300006883 | Sediment | MHAIDIRTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0079303_100637742 | 3300006930 | Deep Subsurface | MAAEVSGEVVIQDEEYANAEYRRFLREKDKYMDFDEFCRQEGI* |
Ga0079303_101679891 | 3300006930 | Deep Subsurface | AEIASEILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0079303_104625942 | 3300006930 | Deep Subsurface | MAAEIAREVLSKEEEYADAEYRRFLKEKDKYVDFDEFCRQEGI* |
Ga0115940_10089663 | 3300008805 | Sediment | MAVEISREVIIQDEEYADAEYRRFLREEDKYMDFDEFCCQEGI* |
Ga0105098_103518422 | 3300009081 | Freshwater Sediment | MAAEISREVTIQDEEYADAEYRRFLREKDKYMDFDEFCRQEGI* |
Ga0105098_103965441 | 3300009081 | Freshwater Sediment | MAAEVVREVLTKDEEYADAEYRRFLKEKEKYMDFDEFCRQEGI* |
Ga0105099_107262173 | 3300009082 | Freshwater Sediment | MAAEVAREVLTKEEEYADSEYRRFLKEKDKYMDFDEFCRQEGI* |
Ga0105103_101563062 | 3300009085 | Freshwater Sediment | MAAEVAREVLTKEEEYADAEYRRFLKEKDKYMDFDEFCRREGI* |
Ga0105103_108844552 | 3300009085 | Freshwater Sediment | MAAEIASEILTDEEYANAEYRRFLREKDKYVDFDECCRQEGI* |
Ga0102851_104397674 | 3300009091 | Freshwater Wetlands | MAAEIASEILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0102851_132687462 | 3300009091 | Freshwater Wetlands | MAAEVSGEVVIQDEEYANAEYRRFLREKDKYMDFDEFCLQEGI* |
Ga0115026_104502441 | 3300009111 | Wetland | EILTDEEYADAEYRRFLREKDKYVDLDEFCRQEGI* |
Ga0115026_105625251 | 3300009111 | Wetland | MIEMAAKVSGEVVIQDEEYANAEYRRFLREKDKYMDFDEFCRQEGI* |
Ga0115027_102929581 | 3300009131 | Wetland | MAAEVVAKEILTDEEYADAEYRRFLKEKDKYVDFDEFCRKEGI* |
Ga0115027_106640851 | 3300009131 | Wetland | MIEMAAEVSGEVVIQDEEYANAEYRRFLREKDKYMDFDEFCRQEGI* |
Ga0115027_109325071 | 3300009131 | Wetland | VSGEVVIQDEEYANAEYRRFLREKDKYMDFDEFCRQEGI* |
Ga0115027_117505733 | 3300009131 | Wetland | MAAEIANQVLTDEEYADAEYRRFLKEKDKYTDFDEFCRKEGI* |
Ga0105091_101583072 | 3300009146 | Freshwater Sediment | MAAEVVREVLTKEEEYADAEYRRFLKEKEKYMDFDEFCRREGI* |
Ga0105102_106256651 | 3300009165 | Freshwater Sediment | MAAEVAREVLTKEDEYADAEYRRFLKEKEKYMDFD |
Ga0105104_100557694 | 3300009168 | Freshwater Sediment | MAAEVASEILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI* |
Ga0105104_103944531 | 3300009168 | Freshwater Sediment | VAREVLTKEEEYADAEYRRFLKEKEKYMDFDEFCRREGI* |
Ga0115028_105227012 | 3300009179 | Wetland | MAAEIAREVLSKEEEYADAEYRRFLKEKDKYVDFDEFCRQEEI* |
Ga0115028_114259171 | 3300009179 | Wetland | MAAEIASEILTDEEYADAEYRRFLREKDKYVDFDEFCR |
Ga0103809_10001377 | 3300009388 | Enrichment Culture | MAAEVVRKILTDEEYADAEYRRFLKEKDKYVDFDEFCRKEGI* |
Ga0130025_11382584 | 3300009566 | Aquifer Solids | MAAEITKEVQTEEEVYADAEYRKFLKEKSQYKDFDEFCREQGI* |
Ga0116182_11733463 | 3300009666 | Anaerobic Digestor Sludge | MSKESGELNMAAEIASEVLTDEEYADAEYRRFLKEKDKYMDFDEFCREEGI* |
Ga0116173_10858593 | 3300009674 | Anaerobic Digestor Sludge | MAAEIANKVLNDEEYADAEYRRFLKEKDKYVDFDKFCRKEGI* |
Ga0116171_102686492 | 3300009692 | Anaerobic Digestor Sludge | MAAEIAREILTDEEYADAEYRRLLKEKDKYMDFDEFCREEGI* |
Ga0116141_104586311 | 3300009693 | Anaerobic Digestor Sludge | LNMAAEIASEVLTDEEYADEQYRRFLKEKDQYMDFDEFCREEGI* |
Ga0116177_103658981 | 3300009696 | Anaerobic Digestor Sludge | TRKGARRIEMAAEVSGEVVIQDEEYANAEYRRFLREKDKYMDFDEFCRQEGI* |
Ga0136653_100182252 | 3300010319 | Anoxic Lake Water | MVMMAAEVAKEILTDEEKYADAEYRRFLKEKDKYVDFDEFCRREGI* |
Ga0116248_101965594 | 3300010351 | Anaerobic Digestor Sludge | IASKVLADEEYADAEYRRFLKEKDKYMDFDEFCREEGI* |
Ga0116248_105199023 | 3300010351 | Anaerobic Digestor Sludge | MAAQVVRKILTDEEYADAEYRRFLKEKDKYVDFDEFCREEGI* |
Ga0116247_109740564 | 3300010352 | Anaerobic Digestor Sludge | MAAEIAREILTDEEYADAEYRRLLREKDKYMDFDEFC |
Ga0116236_100507555 | 3300010353 | Anaerobic Digestor Sludge | MAAEIASEVLTDEEYADEQYRRFLKEKDQYMDFDEFCREEGI* |
Ga0116251_103589233 | 3300010365 | Anaerobic Digestor Sludge | GELNMAAEIAIEVLADEEYADAEYRRFLKEKDKYMDFDEFCREEGI* |
Ga0163209_11793722 | 3300013090 | Freshwater | MAAEVTREVLTDEEEYADAEYRRFLREKDKYVDFDDFCRQEGI* |
Ga0182010_100616963 | 3300014490 | Fen | MAAEITGKAITKEEEYADAEYRRFLKEKDKYVDFDEFCRKKGI* |
Ga0182010_100993903 | 3300014490 | Fen | MAAEVAREVFTNEEEYADAEYKRFLKEKDKYMDFDEFCRKEGI* |
Ga0182010_102728063 | 3300014490 | Fen | MAAEVAREVLTKEEDYADAEYRRFLREKDKYMDFDEFCRQEGI* |
Ga0182017_103584111 | 3300014494 | Fen | MAAEVAREVLTKEEEYADAEYRRFLKEKDKYIDFDEFCRQEGI* |
Ga0182011_100010124 | 3300014496 | Fen | MGYRGLNMAAEVAREVLTKEEDYADAEYRRFLKEKDKYMDFDEFCRQEDI* |
Ga0182021_101945842 | 3300014502 | Fen | MAAEVAREVLTKEEEYADSEYRRFLKEKDKYMDFDEFCRQERI* |
Ga0182021_102023227 | 3300014502 | Fen | MAPDELLTKDYADAEYRRFLKEKDKYMDFDEFCRQEEAKVKSL* |
Ga0182021_103853061 | 3300014502 | Fen | AITKEEEYADAEYRRFLKEKDKYVDFDEFCRKKGI* |
Ga0182021_104794142 | 3300014502 | Fen | MAAEVAREVFTKEEDYADAEYRRFLREKDKYMDFDEFCRQEGI* |
Ga0182021_121948412 | 3300014502 | Fen | MAAEVAREVLTNKEEYADAEYKRFLKEKDKYMDFDEFCRKEGI* |
Ga0181520_100066162 | 3300017988 | Bog | MAADSAKSVLDKDEEYVDAEYRKFLEEKDKYVNFDEFCREKGI |
Ga0187886_11775782 | 3300018018 | Peatland | MAAEVAKETPVEAASTDEEYADAEYKRFLKEKDKYVDFDEFCRQEEI |
Ga0180029_12165253 | 3300019224 | Anaerobic Biogas Reactor | MAAQVVRKILTDEEYADAEYRRFLKEKDKYVDFDEFCRKEGI |
Ga0179949_10009262 | 3300019225 | Anaerobic Digestor Sludge | MAAEIAREILTDEEYADAEYRRLLREKDKYMDFDEFCREEGI |
Ga0179944_11308942 | 3300019236 | Anaerobic Digestor Sludge | MAAQVAREILNDEEYADAEYQRFLKEKDKYVDFDEFCRKEEI |
Ga0182028_11628622 | 3300019788 | Fen | MGYRGLNMAAEVAREVLTKEEDYADAEYRRFLKEKDKYMDFDEFCRQEDI |
Ga0207193_10001875 | 3300020048 | Freshwater Lake Sediment | MAAEISREVISLDEEYADAEYRRFLREKDKYMDFDEFCRQEGI |
Ga0194039_10263066 | 3300020163 | Anoxic Zone Freshwater | MHAIDILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI |
Ga0214088_11508232 | 3300020814 | Granular Sludge | MAAEVVRKILTDEEYADAEYRRFLKEKDKYVDFDEFCRKEGI |
Ga0212121_100995644 | 3300022556 | Anoxic Lake Water | MVMMAAEVAKEILTDEEKYADAEYRRFLKEKDKYVDFDEFCRREGI |
Ga0212121_104758651 | 3300022556 | Anoxic Lake Water | MAAEVTREVLTDEEEYADAEYRRFLREKDKYVDFDDFCRQEGI |
Ga0236339_12098182 | 3300022650 | Freshwater | MAAEITGKAITKEEEYADAEYRRFLKEKDKYVDFDEFCRKKGI |
Ga0255811_103309816 | 3300023207 | Anaerobic Digester Digestate | MAAEVGRKILTDEEYADAEYRRFLKEKDKYVDFDEFCRKEGI |
Ga0224521_10968532 | 3300024233 | Soil | MAAEVAREVLTKEEDYADAEYRRFLREKDKYMDFDEFCRQEGI |
Ga0208584_10069762 | 3300025533 | Arctic Peat Soil | MAPEELLTKDYADAEYRRFLKEKDKYMDFDEFCRQEEI |
Ga0209125_11373342 | 3300025600 | Arctic Peat Soil | MAAEVAREVFINEEEYADAEYKRFLKEKDKYMDFDEFCRQEGI |
Ga0209744_11153524 | 3300025692 | Arctic Peat Soil | AEVAREVFINEEEYADAEYKRFLKEKDKYMDFDEFCRQEGI |
Ga0209507_10173525 | 3300025706 | Anaerobic Digestor Sludge | MAAEIAIEVLADEEYADAEYRRFLKEKDKYMDFDEFCREEGI |
Ga0209507_10388052 | 3300025706 | Anaerobic Digestor Sludge | MAAEIASEVLTDEEYADAEHRRFLKEKDKYTDFDEFCRKEGF |
Ga0208458_10507462 | 3300025714 | Anaerobic Digestor Sludge | MAAEIANKVLNDEEYADAEYRRFLKEKDKYVDFDKFCRKEGI |
Ga0208197_10124469 | 3300025720 | Anaerobic Digestor Sludge | MAAEIANQVLADEEYADAEYRRFLKEKDKYTDFDEFCRKEGI |
Ga0209606_10265271 | 3300025730 | Anaerobic Digestor Sludge | MAAEIASEVLTDEEYADAEYRRFLKEKDKYMDFDEFCREEGI |
Ga0208459_12418062 | 3300025748 | Anaerobic Digestor Sludge | MAAEIANKVLNDEEYADAEYRRFLKEKDKYMDFDEFCRKEGI |
Ga0209539_10481101 | 3300025764 | Arctic Peat Soil | AEVAREVLTKEEDYADAEYRRFLREKDKYMDFDEFCRQEGI |
Ga0209748_10009358 | 3300025836 | Arctic Peat Soil | MGYRGLNMAAEVAREVLTKEEDYADAEYRRFLKEKDKYMDFDEFCRQEGI |
Ga0209124_103298102 | 3300025852 | Arctic Peat Soil | KMAAEVAREVLTKEEDYADAEYRRFLKEKDKYMDFDEFCRQEGI |
Ga0209099_11009525 | 3300025858 | Anaerobic Digestor Sludge | MAAEIASEILTDEEYADAEYRRFLREKDTYMDFDE |
Ga0209098_10511803 | 3300025867 | Anaerobic Digestor Sludge | MAAEIASEILTDEEYADAEYRRFLREKDTYMDFDEFCREEDI |
Ga0209098_12961742 | 3300025867 | Anaerobic Digestor Sludge | MAAEIAREILTDEEYADAEYRRLLKEKDKYMDFDEFCREEGI |
Ga0209340_10191623 | 3300027419 | Bioremediated Contaminated Groundwater | MAAEVAREVLTTKEEEYADAEYRRFLKEKDKYADFDEFCREEGI |
Ga0209077_11650783 | 3300027675 | Freshwater Sediment | MAAEVVREVLTKEEEYADAEYRRFLKEKEKYFDFYEFCRRE |
Ga0209704_10036734 | 3300027693 | Freshwater Sediment | MAAEIANQVLTDEEYADAEYRRFLKEKDKYMDFDEFCRKEGI |
Ga0208980_100431232 | 3300027887 | Wetland | MAAEIAREVLTEEEQYADAEYRRFLKDKDKYKDFDEFCHEQGI |
Ga0208980_104111262 | 3300027887 | Wetland | MAAGIAREVLTEEEQYADAEYRRFLKEKDKYIDFDEFCREQGI |
Ga0209496_106460522 | 3300027890 | Wetland | MAAEIASEILTDEEYADAEYRRFLREKDKYVDFDE |
Ga0209777_102225673 | 3300027896 | Freshwater Lake Sediment | MAAEVVTKENLTDEEYADAEYRKFLKEKDKYVDFDEFCREEEI |
Ga0209777_102406012 | 3300027896 | Freshwater Lake Sediment | MAAEITGNAITKEEEYADAEYRLFLKEKDKYVGFDEFCRKIGI |
Ga0209668_109094822 | 3300027899 | Freshwater Lake Sediment | MHAIDILTDEEYADAEYRLFLREMDKYVDFDEFCRQEGI |
Ga0209820_12147982 | 3300027956 | Freshwater Sediment | MAAEISREVTIQDEEYADAEYRRFLREKDKYMDFDEFCRQEGI |
Ga0209749_100085722 | 3300027958 | Bioremediated Contaminated Groundwater | MAAEIASEILTDEEYADAEYRRFLREKDKYADFDEFCRQEGI |
Ga0209749_12028771 | 3300027958 | Bioremediated Contaminated Groundwater | MDAEIAREILTDEEYADAEYRRLLREKDKYMDFDEFCREEGI |
Ga0268281_100013030 | 3300028156 | Saline Water | MAAEVAIEVLSDEEEYADAEYRRFLREKDKYVDFDDFCRQEGI |
Ga0268279_11000131 | 3300028169 | Saline Water | MAAEVAIEVLSDEEEYADAEYRRFLREKDKYVDFDDFC |
(restricted) Ga0247840_1000137327 | 3300028581 | Freshwater | MAAEIASEILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI |
Ga0302164_100363572 | 3300028664 | Fen | MAAEVAREVLTKEEDYVDAEYRRFLREKDKYMDFDEFCRQEGI |
Ga0167179_10004842 | 3300029252 | Biosolids | MAAEIASKVLADEEYADAEYRRFLKEKDKYMDFDEFCREEGI |
Ga0265297_108758231 | 3300029288 | Landfill Leachate | VNMAAEVVRKILTDEEYADAEYRRFLKEKDKYVDFDEFCRKEGI |
Ga0311022_123852632 | 3300029799 | Anaerobic Digester Digestate | MASEIASEVLKDEEYADAEYRRFHKEKDKYMDFDEFCREEGI |
Ga0311333_107261923 | 3300030114 | Fen | MAAEVAREVLTKEEEYADSEYRRFLKEKDKYMDFDEFCRQERI |
Ga0302323_1013509472 | 3300031232 | Fen | REVFTNKEEYADAEYKRFLKEKDKYMDFDEFCRKEGI |
Ga0315291_101262053 | 3300031707 | Sediment | MATEVSRETLTDEEYADAEYRRFLKEKDKYVDFDEFCRKEEI |
Ga0315291_106533263 | 3300031707 | Sediment | MDMMAAEVAKEILTDEEKYADAEYRRFLKEKDKYVDFDEFCRREGI |
Ga0315293_100931552 | 3300031746 | Sediment | MDMMVDEVAKEILTDEEKYADAEYRRFLKEKDKYVDFDEFCRREGI |
Ga0315288_100979164 | 3300031772 | Sediment | ATEVSRETLTDEEYADAEYRRFLKEKDKYVDFDEFCRKEEI |
Ga0315282_100800894 | 3300032069 | Sediment | MDMMAAEVAKEILTDEEKYADAEYRRFLKEKDKYGL |
Ga0315282_101367635 | 3300032069 | Sediment | MVMMAAEVAKEILTDEEKYADAEYRRFLREKDKYVDFDEFCRREGI |
Ga0315292_101386763 | 3300032143 | Sediment | MHAIDILTDEEYVDAEYRQFLIEKDKYVDFDEFCRQEGI |
Ga0315292_102981631 | 3300032143 | Sediment | MAAEIASEILNDEEYADAEYRRFLREKDKYVDFDEFCRQEGI |
Ga0315295_106728421 | 3300032156 | Sediment | MQAIDILTDEEYDYAEYGRFLREKDKYVDFDEFCRQEGI |
Ga0315281_120869591 | 3300032163 | Sediment | MAAEISREVIIQDEEYADAEYRRFLREKDKYMDFDEFCRQEGI |
Ga0315276_114321851 | 3300032177 | Sediment | MAAEIVAKENLTDEEYAGAEYRRFLKEKDKYVDFDEFC |
Ga0315286_101445125 | 3300032342 | Sediment | MAAEVAREILTDEEYADAEYRRFLREKDKYVDFDEFCRQEGI |
Ga0315287_110377933 | 3300032397 | Sediment | MHAIDILTDEEYADAEYRRFLREKDKYVDFDDFCRQEGI |
Ga0335080_122774531 | 3300032828 | Soil | MAAEITREIQTEEEAYADAEYRKILKEKSQYKDFNEFCREQRI |
Ga0316605_112194552 | 3300033408 | Soil | MAAEVSGEVVIQDEEYANAEYRRFLREKDKYMDFDEFCRQEGI |
Ga0316619_106239732 | 3300033414 | Soil | MIEMAAKVSGEVVIQDEEYANAEYRRFLREKDKYMDFDEFCRQEGI |
Ga0316601_1005481911 | 3300033419 | Soil | MAAEVVAKEILTDEEYADAEYRRFLKEKDKYVDFDEFCRKEGI |
Ga0334817_031039_377_508 | 3300033820 | Soil | MAAEVAREVFTNEEEYADAEYKRFLKEKDKYMDFDEFCRQERI |
Ga0334822_043797_545_676 | 3300034070 | Soil | MAAEVAREVLTKEEEYADAEYRRFLKEKDKYIDFDEFCRQEGI |
Ga0370480_0005744_227_358 | 3300034169 | Untreated Peat Soil | MAAEVAREVLTKEEEYADAEYRRFLKEKDKYMDFDEFCRQEGI |
Ga0370480_0019152_1355_1486 | 3300034169 | Untreated Peat Soil | MAAEISREVIGKEEEYADTEYRRFLKEKSKYVDFDEFCRQEGI |
⦗Top⦘ |