NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091072

Metagenome / Metatranscriptome Family F091072

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091072
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 55 residues
Representative Sequence MAGTVKETVMPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL
Number of Associated Samples 93
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 5.56 %
% of genes near scaffold ends (potentially truncated) 21.30 %
% of genes from short scaffolds (< 2000 bps) 77.78 %
Associated GOLD sequencing projects 86
AlphaFold2 3D model prediction Yes
3D model pTM-score0.42

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (90.741 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(13.889 % of family members)
Environment Ontology (ENVO) Unclassified
(29.630 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(29.630 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.94%    β-sheet: 0.00%    Coil/Unstructured: 65.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.42
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF05016ParE_toxin 25.93
PF15738YafQ_toxin 4.63
PF13432TPR_16 3.70
PF01702TGT 1.85
PF00528BPD_transp_1 1.85
PF13414TPR_11 1.85
PF13649Methyltransf_25 1.85
PF13598DUF4139 0.93
PF01676Metalloenzyme 0.93
PF07876Dabb 0.93
PF13384HTH_23 0.93
PF01032FecCD 0.93
PF02452PemK_toxin 0.93
PF01345DUF11 0.93
PF10899AbiGi 0.93
PF10143PhosphMutase 0.93
PF00326Peptidase_S9 0.93
PF01936NYN 0.93
PF13401AAA_22 0.93
PF03237Terminase_6N 0.93
PF02371Transposase_20 0.93
PF01451LMWPc 0.93
PF13646HEAT_2 0.93
PF03681Obsolete Pfam Family 0.93
PF14494DUF4436 0.93
PF00708Acylphosphatase 0.93
PF17209Hfq 0.93
PF12847Methyltransf_18 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0343Queuine/archaeosine tRNA-ribosyltransferaseTranslation, ribosomal structure and biogenesis [J] 1.85
COG1549Archaeosine tRNA-ribosyltransferase, contains uracil-DNA-glycosylase and PUA domainsTranslation, ribosomal structure and biogenesis [J] 1.85
COG1432NYN domain, predicted PIN-related RNAse, tRNA/rRNA maturationGeneral function prediction only [R] 0.93
COG2337mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin moduleDefense mechanisms [V] 0.93
COG3547TransposaseMobilome: prophages, transposons [X] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.74 %
UnclassifiedrootN/A9.26 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908028|beta3_all_NODE_249662_len_6058_cov_8_928689All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1126108Open in IMG/M
2124908038|B3_all_c_ConsensusfromContig203946All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112776Open in IMG/M
2140918024|NODE_24409_length_950_cov_12.071579All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121000Open in IMG/M
3300001213|JGIcombinedJ13530_107342745All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112507Open in IMG/M
3300001410|JGI20179J14886_1000058Not Available8758Open in IMG/M
3300001580|Draft_10263650All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112754Open in IMG/M
3300002219|SCADCLC_10133939All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112604Open in IMG/M
3300002569|JGI24136J36422_10078924All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112916Open in IMG/M
3300002596|draft_1414845All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix3970Open in IMG/M
3300002703|draft_10927724All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112705Open in IMG/M
3300002703|draft_11041994Not Available1740Open in IMG/M
3300002821|Iso3TCLC_10009834Not Available2569Open in IMG/M
3300003432|JGI20214J51088_10533898All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112749Open in IMG/M
3300003432|JGI20214J51088_10713780All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112642Open in IMG/M
3300003852|Ga0031655_10159044All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112874Open in IMG/M
3300005216|Ga0068994_10243315All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112524Open in IMG/M
3300005259|Ga0071344_1024760All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix harundinacea5188Open in IMG/M
3300005263|Ga0071346_1009181All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix8929Open in IMG/M
3300005326|Ga0074195_1001963All Organisms → cellular organisms → Archaea25359Open in IMG/M
3300005326|Ga0074195_1003069All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix16648Open in IMG/M
3300006651|Ga0101725_129263All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112512Open in IMG/M
3300006835|Ga0101935_1019941All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121014Open in IMG/M
3300006930|Ga0079303_10153193All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112903Open in IMG/M
3300007051|Ga0102624_134401All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112533Open in IMG/M
3300007089|Ga0102622_1060747All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112508Open in IMG/M
3300008982|Ga0116011_1019228All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112879Open in IMG/M
3300009053|Ga0105095_10278395All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112919Open in IMG/M
3300009085|Ga0105103_10128785Not Available1329Open in IMG/M
3300009085|Ga0105103_10233518All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112990Open in IMG/M
3300009091|Ga0102851_10877383All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112966Open in IMG/M
3300009119|Ga0117938_125631All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112506Open in IMG/M
3300009131|Ga0115027_10305329All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121072Open in IMG/M
3300009146|Ga0105091_10734760Not Available520Open in IMG/M
3300009153|Ga0105094_10375904All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112822Open in IMG/M
3300009166|Ga0105100_10475650All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112760Open in IMG/M
3300009167|Ga0113563_10588616All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121230Open in IMG/M
3300009171|Ga0105101_10547448All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112571Open in IMG/M
3300009179|Ga0115028_10672420All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112786Open in IMG/M
3300009179|Ga0115028_10905287All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112698Open in IMG/M
3300009297|Ga0115977_1030352All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112620Open in IMG/M
3300009676|Ga0116187_1011855All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii6131Open in IMG/M
3300009692|Ga0116171_10193479All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121154Open in IMG/M
3300009694|Ga0116170_10112473All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii1710Open in IMG/M
3300010345|Ga0116253_10729345All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112592Open in IMG/M
3300010357|Ga0116249_10428914All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121217Open in IMG/M
3300013290|Ga0172517_100544All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix13479Open in IMG/M
3300014204|Ga0172381_10002493All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii20302Open in IMG/M
3300014205|Ga0172380_11116421All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112555Open in IMG/M
3300014490|Ga0182010_10217349All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121006Open in IMG/M
3300014490|Ga0182010_10619797All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112605Open in IMG/M
3300014496|Ga0182011_10017320Not Available5263Open in IMG/M
3300014496|Ga0182011_10555288All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112734Open in IMG/M
3300014502|Ga0182021_10961501All Organisms → cellular organisms → Archaea1027Open in IMG/M
3300014502|Ga0182021_11560873All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii → Methanothrix soehngenii GP6795Open in IMG/M
3300014502|Ga0182021_12695428All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112597Open in IMG/M
3300019209|Ga0179951_1035112All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix537Open in IMG/M
3300019225|Ga0179949_1016166All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix1046Open in IMG/M
3300020163|Ga0194039_1004642All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii6393Open in IMG/M
3300020228|Ga0194040_1032574All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121489Open in IMG/M
3300021074|Ga0194044_10035203Not Available2109Open in IMG/M
3300021074|Ga0194044_10296544All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112614Open in IMG/M
3300022556|Ga0212121_10353701All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112975Open in IMG/M
3300023311|Ga0256681_11567620All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112758Open in IMG/M
3300025136|Ga0209610_1169057All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112701Open in IMG/M
3300025279|Ga0208047_1023941All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121754Open in IMG/M
3300025436|Ga0208103_1047870All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112591Open in IMG/M
3300025533|Ga0208584_1007728All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1122820Open in IMG/M
3300025548|Ga0208716_1047890All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112916Open in IMG/M
3300025714|Ga0208458_1015161All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix3755Open in IMG/M
3300025724|Ga0208196_1028007All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix2544Open in IMG/M
3300027715|Ga0208665_10060985All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121117Open in IMG/M
3300027722|Ga0209819_10246298All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112620Open in IMG/M
3300027743|Ga0209593_10062095All Organisms → cellular organisms → Archaea → environmental samples → uncultured archaeon1419Open in IMG/M
3300027890|Ga0209496_10132858All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121114Open in IMG/M
3300027896|Ga0209777_10012576All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → Methanothrix soehngenii8782Open in IMG/M
3300027900|Ga0209253_10556428All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112848Open in IMG/M
3300027902|Ga0209048_10565490All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112761Open in IMG/M
(restricted) 3300028581|Ga0247840_10095753All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121980Open in IMG/M
(restricted) 3300029286|Ga0247841_10086828All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix2647Open in IMG/M
3300029959|Ga0272380_10003144All Organisms → cellular organisms → Archaea31516Open in IMG/M
3300029959|Ga0272380_10084111All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1122564Open in IMG/M
3300029984|Ga0311332_10550767All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112909Open in IMG/M
3300029990|Ga0311336_11451650All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112603Open in IMG/M
3300030838|Ga0311335_10480336All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112862Open in IMG/M
3300031539|Ga0307380_11326696All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112548Open in IMG/M
3300031565|Ga0307379_10083674All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia3515Open in IMG/M
3300031707|Ga0315291_10019565Not Available8100Open in IMG/M
3300031726|Ga0302321_102088541All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112659Open in IMG/M
3300031746|Ga0315293_10438841All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121020Open in IMG/M
3300031834|Ga0315290_10652173Not Available910Open in IMG/M
3300031873|Ga0315297_11174963All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112629Open in IMG/M
3300031997|Ga0315278_10152685All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix2361Open in IMG/M
3300031997|Ga0315278_10877733All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112901Open in IMG/M
3300031997|Ga0315278_11135405All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix770Open in IMG/M
3300032046|Ga0315289_10920524All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112748Open in IMG/M
3300032156|Ga0315295_10677707All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121041Open in IMG/M
3300032156|Ga0315295_11627623All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112618Open in IMG/M
3300032342|Ga0315286_10825868All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112936Open in IMG/M
3300032397|Ga0315287_10623093All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanothrix sp.1277Open in IMG/M
3300032401|Ga0315275_12694963All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112511Open in IMG/M
3300032516|Ga0315273_12238326All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112640Open in IMG/M
3300032516|Ga0315273_12382181All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112615Open in IMG/M
3300033418|Ga0316625_102234252All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112546Open in IMG/M
3300033481|Ga0316600_10781115All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112673Open in IMG/M
3300033482|Ga0316627_100247854All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia1418Open in IMG/M
3300033521|Ga0316616_102244946All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin112728Open in IMG/M
3300033891|Ga0334811_051861All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin1121101Open in IMG/M
3300034281|Ga0370481_0295606Not Available587Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment13.89%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment8.33%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge8.33%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen6.48%
SedimentEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment5.56%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments4.63%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland3.70%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment3.70%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater3.70%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.70%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.70%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.70%
Bioremediated Contaminated GroundwaterEngineered → Bioremediation → Tetrachloroethylene And Derivatives → Tetrachloroethylene → Unclassified → Bioremediated Contaminated Groundwater3.70%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.78%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil2.78%
Anaerobic Enrichment CultureEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Anaerobic Enrichment Culture1.85%
Anoxic Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water1.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.85%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.85%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.85%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.93%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.93%
Lake SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
Anoxic AquiferEnvironmental → Terrestrial → Deep Subsurface → Aquifer → Unclassified → Anoxic Aquifer0.93%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.93%
Hydrocarbon Resource EnvironmentsEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908028Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2124908038Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog Site B3EnvironmentalOpen in IMG/M
2140918024Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300001410Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012EnvironmentalOpen in IMG/M
3300001580Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6EngineeredOpen in IMG/M
3300002219Tailings pond microbial communities from Northern Alberta -Short chain hydrocarbon degrading methanogenic enrichment culture SCADC:EngineeredOpen in IMG/M
3300002569Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212EnvironmentalOpen in IMG/M
3300002596Hydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10EngineeredOpen in IMG/M
3300002703Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Oil sands tailings Tailings Pond 5 - 2012TP5EngineeredOpen in IMG/M
3300002821Iso-alkanes.Hi.seq-Iso3TEngineeredOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003852Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HBEnvironmentalOpen in IMG/M
3300005216Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLA_D2EnvironmentalOpen in IMG/M
3300005259Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid and Glucose under anaerobic conditions - HA Sample 1EnvironmentalOpen in IMG/M
3300005263Freshwater pond sediment microbial communities from Middleton WI, enriched with Humic Acid Only under anaerobic conditions - HA Sample 3EnvironmentalOpen in IMG/M
3300005326Bioremediated contaminated groundwater from EPA Superfund site, New Mexico - Sample HSE6-23EngineeredOpen in IMG/M
3300006651T8 (1) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 timesEnvironmentalOpen in IMG/M
3300006835Combined Assembly of Gp0125097, Gp0125101, Gp0125102EnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007051Combined Assembly of 100bp T18 (BES) Gp0123708, Gp0123962, Gp0123963EnvironmentalOpen in IMG/M
3300007089Combined Assembly of 100 bp T18 (live) Gp0123698, Gp0123960, Gp0123961EnvironmentalOpen in IMG/M
3300008982Combined Assembly of De NOVO T5 (live) Tyne Sediment Benzoate Gp0125094, Gp0125095, Gp0125096EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009119Lake sediment microbial communities from Leach Lake, MNEnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009146Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009179Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1EnvironmentalOpen in IMG/M
3300009297T10 (3) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO (2)EnvironmentalOpen in IMG/M
3300009676Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA6_MetaGEngineeredOpen in IMG/M
3300009692Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaGEngineeredOpen in IMG/M
3300009694Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaGEngineeredOpen in IMG/M
3300010345AD_JPNAca2EngineeredOpen in IMG/M
3300010357AD_USSTcaEngineeredOpen in IMG/M
3300013290Enriched microbial communities from a natural gas condensate-contaminated anoxic aquifer near Ft. Lupton, CO, USA ? 13C-labelled, 2 mo incubationEnvironmentalOpen in IMG/M
3300014204Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaGEngineeredOpen in IMG/M
3300014205Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaGEngineeredOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300019209Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW3_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019225Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW1_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300020163Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-8mEnvironmentalOpen in IMG/M
3300020228Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-10mEnvironmentalOpen in IMG/M
3300021074Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-17mEnvironmentalOpen in IMG/M
3300022556Kivu_combined assemblyEnvironmentalOpen in IMG/M
3300023311Combined Assembly of Gp0281739, Gp0281740, Gp0281741EnvironmentalOpen in IMG/M
3300025136Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 275m metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025279Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m (SPAdes)EnvironmentalOpen in IMG/M
3300025436Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA7.5M (SPAdes)EnvironmentalOpen in IMG/M
3300025533Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025548Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025714Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025724Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNNA7_MetaG (SPAdes)EngineeredOpen in IMG/M
3300027715Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027890Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028581 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17mEnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300029959EPA Superfund site combined assemblyEngineeredOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032156Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300034281Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
beta3_all_012687302124908028SoilMAGTVKETVMPVREEPKEDIKALLEGTDAAWTQYKQGKGTRVTSAKELDAFLDSL
B3_all_c_035276102124908038SoilMAGTVKETVMPVREEPKEDIKALLEGTDVAWTQYKQGKGTRVTSAKE
B_all_v_001831602140918024SoilMAGTVKETVMPVREEPKEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL
JGIcombinedJ13530_10734274523300001213WetlandMAGTVKETVMPVREEPKEDIKALLEGTDAAWTQYKQGKGTRVTSANELDAFLDSF*
JGI20179J14886_100005853300001410Arctic Peat SoilMAGTVKETVMPVREEPKEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL*
Draft_1026365023300001580Hydrocarbon Resource EnvironmentsTMKEAVAPVREETEEEIRALLDGAQAAWAQYKRGQGVRITSTKELDAFLDSL*
SCADCLC_1013393913300002219Hydrocarbon Resource EnvironmentsWPIYLYEACYLIFMAGIMKEAVAPVREETEEEIRTLLEGAQAAWAQYKQGQGVRITSTKELDAFLDSL*
JGI24136J36422_1007892413300002569Arctic Peat SoilMAGTVKETVMPIREEPEEDIKALLEGTDIAWTQYKQGKGTRVTSAKELDAFLDRL*
draft_141484543300002596Hydrocarbon Resource EnvironmentsMAGIMKEAVAPVREETEEEIRTLLEGAQAAWAQYKQGQGVRITSTKELDAFLDSL*
draft_1092772413300002703Hydrocarbon Resource EnvironmentsETAMPVRGETEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL*
draft_1104199423300002703Hydrocarbon Resource EnvironmentsMAGIMKEAVAPVREETEEEIRTLLDGAQAVWAQYKRGQGARITSTKELVAFLDSL*
Iso3TCLC_1000983443300002821Hydrocarbon Resource EnvironmentsMAGIMKEAVAPVREEAEEEIRTLLDGAQAVWAQYKQGQSVRIPSTKELDAFLDSL*
JGI20214J51088_1053389823300003432WetlandMAGTVKKTAMPVRGETEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL*
JGI20214J51088_1071378013300003432WetlandHFISMASTVKETVMPVQEETEEDIKALLEGTDAAWAQYKQGQGTRVAGTKELDAFLDSL*
Ga0031655_1015904423300003852Freshwater Lake SedimentMAGTVKETIAPICEETEEDIKALLKGTDVAWAQYKRCHGTQVTSTKELDEFLDSL*
Ga0068994_1024331523300005216Natural And Restored WetlandsMAGTMKETAMPVRGETEEEIKALLKGTDVAWTQYKRDHGTRVTGAKELDAFLDSL*
Ga0071344_102476073300005259Anaerobic Enrichment CultureMAGTVKETIAPICEETKEDIKALLKGTDVAWAQYKRCHGTKVTDTKELDEFLDSL*
Ga0071346_100918153300005263Anaerobic Enrichment CultureMAGIVKETAMPVRGETEEEIKALLKGTDVAWTQYKRDNGTRVTSAKELDAFLDSL*
Ga0074195_1001963133300005326Bioremediated Contaminated GroundwaterMAGTVKDTILPVHKTPEEDIKTLLEGTDIAWAQYKQGQGTRVTSAKELDAFLDSL*
Ga0074195_1003069143300005326Bioremediated Contaminated GroundwaterMTMAGTVKETVLPVRDEEPEEDIKTLLEGTDVAWAQYKQGRGTRVTSAKELDAFLDSL*
Ga0101725_12926323300006651SedimentMAGTMKETAMPVRGETDEEIKALLKGTDVAWTQYKRDHGTRVTS
Ga0101935_101994113300006835SedimentMAGTMKETAMPVRGETDEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL*
Ga0079303_1015319313300006930Deep SubsurfaceQRSDGDRQTNELWPIYLYKAHHFISMAGTVKETVMPVQEETEEDIKALLEGTDAAWAQYKQGQGTRVAGTKELDAFLDSL*
Ga0102624_13440113300007051SedimentMAGTVKETIAPICEETEEDIKALLKGTDVAWAQYKRCHGTKVTDTKELDDFLD
Ga0102622_106074713300007089SedimentMAGTVKETAMPVRGEAEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL*
Ga0116011_101922813300008982SedimentMAGTVKETIAPICKETEEDIKALLKGTDVAWAQYKRCHGTKVTDTKELDEFLDSL*
Ga0105095_1027839533300009053Freshwater SedimentMAGTMKKTVMPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL*
Ga0105103_1012878543300009085Freshwater SedimentGTMKEAVAPVREETEEEITTLLEGAKIAWAQYKRGQGARITSAKELDAFLDSL*
Ga0105103_1023351823300009085Freshwater SedimentMAGTVKEPILPVREEPGEEIKTLLEGTDAAWAQYKQGQGTRVTSAKELDALLDSL*
Ga0102851_1087738323300009091Freshwater WetlandsMAGTVKETVMPVREEAKEDIKTLLEGTDVAWAQYKRGQGTQVTNTKELDTFLDSL*
Ga0117938_12563113300009119Lake SedimentMAGTMKKTVMPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVASAKELDAFLDSL*
Ga0115027_1030532913300009131WetlandMASTVKETVMPVREEAKEDIKTLLEGTDVAWAQYKRCQGTQVTNIKELDTFLDSL*
Ga0105091_1073476013300009146Freshwater SedimentMYVSFMGGTVKETAMPVRGETEEEIKALLKGTDVAWRQYKRDHGT
Ga0105094_1037590423300009153Freshwater SedimentMAGTMKETVKPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL*
Ga0105100_1047565023300009166Freshwater SedimentMAGTLKETVMPVREEPKEDIKALLEGTDAAWAQYKQGKGKRVTSAKELDAFLDSL*
Ga0113563_1058861613300009167Freshwater WetlandsMAGTVKENAIPVRSETEEEIKALLKGTEVAWTQYKRDHGTRVTSAKELDAFLDSL*
Ga0105101_1054744823300009171Freshwater SedimentMAGTMKETVMPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL*
Ga0115028_1067242013300009179WetlandMAGTVKENVMPVRTESEEEIKALLKGTEVAWMQYKRDHGTRVTSAKELDAFLDSL*
Ga0115028_1090528713300009179WetlandMASTVKETVMPVREEAKEDIKTLLEGTDVAWAQYKRGQGTQVTNIKELDTFLDSL*
Ga0115977_103035223300009297SedimentMAGTVRETAMPVRGEAEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELYAFLDSL*
Ga0116187_101185553300009676Anaerobic Digestor SludgeMAGIMKEAVAPVREEAEEEIRTLLDGAQAVWAQYKQGQGVRIPSTKELDAFLDSL*
Ga0116171_1019347913300009692Anaerobic Digestor SludgeMAGTVKEAATPGRSESEEEIKALLKGTELAWTQYKRDQGTRVNSARELDAFLDG
Ga0116170_1011247333300009694Anaerobic Digestor SludgeMAGTVKEAATPVRSETEEEIKALLKGTELAWTQYKRDQGTRVNSSKELDAFLDGL*
Ga0116253_1072934513300010345Anaerobic Digestor SludgeMAGIMKEAVAPVREEAEEEIRTLLDGAQAVWAQYKQGQSVRIPSTK
Ga0116249_1042891423300010357Anaerobic Digestor SludgeMAGTVKENAMPVRSETEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL*
Ga0172517_10054483300013290Anoxic AquiferMAGTMKEAVAPVREETEEEIRTLLEGAQAAWAQYKQGQGVRITSTKELDAFLDSL*
Ga0172381_1000249383300014204Landfill LeachateMNLIASLQSPIYFSMAGTVKEIIAPICEETEEDIKALLKGTDVAWAQYKRCHGTQVTSTKKLDEFLDSL*
Ga0172380_1111642113300014205Landfill LeachateMAGTVKETILPVREDPEEDIKTLLEGTDAAWAQYKQGHGTRVTSAKELDAFLDSL*
Ga0182010_1021734923300014490FenMAGTVKETVMPVREEPEEDIKALLVGTDVAWTQYKQGKGTRVTSAKELDAFLDSL*
Ga0182010_1061979713300014490FenMAGTVKETVMPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL*
Ga0182011_1001732083300014496FenMTGTVKETVMPVREEPEEDIKALREGTDVAWTQYKQGKGTRVTSAKELDAFLDRL*
Ga0182011_1055528823300014496FenMAGTVKETVMPVREEPEEDIKALLVGTDVAWTQYKQGKGTRVTGAKELDAFLDSL*
Ga0182021_1096150113300014502FenMPVREEPKEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAYLDSL*
Ga0182021_1156087323300014502FenMAGTVKETVMPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVASAKELDAFLDSL*
Ga0182021_1269542823300014502FenMPVREEPKEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL*
Ga0179951_103511213300019209Anaerobic Digestor SludgeMKEAVAPVREEAEEEIRTLLDGAQAAWAQYKRGQGARITSARELDAFLDSF
Ga0179949_101616633300019225Anaerobic Digestor SludgeMAGIMKEAVAPVREEAEEEIRTLLDGAQAAWAQYKRGQGARITSARELDAFLDSF
Ga0194039_100464253300020163Anoxic Zone FreshwaterMAGTVKETAMPVRGETEEEIKALLMGTDVAWTQYKRDHGTRVTSAKELDAFLDGL
Ga0194040_103257413300020228Anoxic Zone FreshwaterMAGTVKETAMPVRGETEEEIKALLMGTDVAWTQYKRDHGTRVTSAKELDA
Ga0194044_1003520333300021074Anoxic Zone FreshwaterMAGTVKETIAPICNENEEDINALLKGTDVAWAQYKRCQGTQVTCTKELDEFLDSL
Ga0194044_1029654423300021074Anoxic Zone FreshwaterTVKVTIAPICDETGADIKALLKGTDVAWAQYKQCQGTQVTRNKELDAFLDSL
Ga0212121_1035370123300022556Anoxic Lake WaterMAGAVKENILPAEPEEDIKKLLEGTDTAWAQYMQGQGTRVTSAKELDVFLDSL
Ga0256681_1156762023300023311FreshwaterMAGTVKETVMPVREEPKEDIKALLEGTDAAWTQYKQGKGTRVTGAKELVQLG
Ga0209610_116905713300025136Anoxic Lake WaterMAGTVKENILPAEPEEDIKKLLEGTDTAWAQYMQGQGTRVTSAKELDVFLDSL
Ga0208047_102394133300025279FreshwaterMAGTVKKTVAPVREDSEEDIRTLLEGTDTAWAQYKQGQGKRITSSDELDAFLENL
Ga0208103_104787013300025436FreshwaterMAGTVKETIAPICKETEEDIKALLKGTDVAWVQYKRCQGTKVTDTKELDAFLDSL
Ga0208584_100772813300025533Arctic Peat SoilMAGTVKETVMPIREEPEEDIKALLEGTDIAWTQYKQGKGTRVTSAKELDAFLDRL
Ga0208716_104789033300025548Arctic Peat SoilYLYEAHHRSPMAGTVKETVMPVREEPKEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL
Ga0208458_101516143300025714Anaerobic Digestor SludgeMAGIMKEAVAPVREETEEEIRTLLEGAQAAWAQYKQGQGVRITSTKELDAFLDSL
Ga0208196_102800713300025724Anaerobic Digestor SludgeMAGIMKEAVAPVREEAEEEIRTLLDGAQAVWAQYKQGQSVRIPSTKELDAFLDSL
Ga0208665_1006098533300027715Deep SubsurfaceMAGTVKETVMPVQEETEEDIKALLEGTDAAWAQYKQGQGTRVAGTKELDAFLDSL
Ga0209819_1024629813300027722Freshwater SedimentMYVSFMGGTVKETAMPVRGETEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL
Ga0209593_1006209523300027743Freshwater SedimentMAGTVKETAMPVRGEAEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL
Ga0209496_1013285813300027890WetlandMAETVKETAMPVRGETEEEIKALLKGTEVAWTQYKRDHGTRVTSAKELDAFLDSL
Ga0209777_1001257653300027896Freshwater Lake SedimentMAGTVKETIAPICEETEEDIKALLKGTDVAWAQYKRCHGTQVTSTKELDEFLDSL
Ga0209253_1055642833300027900Freshwater Lake SedimentMAGTVKETITPISEETEEDTKALLKGTDVAWAQYKRCQGTKVASAKELDTFLDSL
Ga0209048_1056549023300027902Freshwater Lake SedimentMANTVKETVMPVQEETEEDIKALLKGTDAAWAQNKQGQGTRVAGTKELDAFLDSL
(restricted) Ga0247840_1009575313300028581FreshwaterMAGTVKETIAPICKENEEDIKALLKGTDIAWVQYKRCQGTKVTDTKELDAFLDSL
(restricted) Ga0247841_1008682853300029286FreshwaterMAGTVKETIAPICEETEEDIKALLKGTDVAWAQYKRCYGTQVTSTKELDEFLDSL
Ga0272380_10003144533300029959Bioremediated Contaminated GroundwaterMAGTVKDTILPVHKTPEEDIKTLLEGTDIAWAQYKQGQGTRVTSAKELDAFLDSL
Ga0272380_1008411143300029959Bioremediated Contaminated GroundwaterMTMAGTVKETVLPVRDEEPEEDIKTLLEGTDVAWAQYKQGRGTRVTSAKELDAFLDSL
Ga0311332_1055076713300029984FenMAGTVKETVMPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL
Ga0311336_1145165013300029990FenKETVMPVREEPEEDIKALLVGTDVAWTQYKQGKGTRVTSAKELDAFLDSL
Ga0311335_1048033633300030838FenSPMAGTVKETVMPVREEPKENIKALLEGTDTAWTQYKQGKGTRVTSAKELDAFLDSL
Ga0307380_1132669623300031539SoilMPVRGEAEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL
Ga0307379_1008367443300031565SoilMKETAMPVRGEAEEEIKALLKGTDVAWTQYKRDHGTRVTSAKELDAFLDSL
Ga0315291_1001956583300031707SedimentMAGTVKKTITPVREDTEEDIRTLLEGTDAAWAQYKQGQGKRITSSEELDTFLDSL
Ga0302321_10208854123300031726FenMAGTVKETVMPVRKEPEEDIKALLEGTDVAWTQYKQGKGTRVTSAKELDAFLDSL
Ga0315293_1043884113300031746SedimentMAGTVKKTVTPVREDTEEDIRTLLEGADAAWAQYKQGQGKRITSSEELDAFLENL
Ga0315290_1065217323300031834SedimentMAGTVKKTITPVREDTEEDIRTLLEGTDAAWAQYKQGQGKRITSSEELDT
Ga0315297_1117496323300031873SedimentMAGTVKETITPISEETEEDIKALLKGTDVAWAQYKRCQGTKVASAKELDAFLDSL
Ga0315278_1015268523300031997SedimentMAGTVKETVMPVHEETKEDIKALLEGTDAAWAQYKQGQGTRVAGAKELDAFLDSL
Ga0315278_1087773313300031997SedimentMVDDVVLLKYDELWPIYLYEAHPLTPMAGTVKETVMPVREEAKEDIKTLLEGTDVAWAQYKRGQGTQVTNIKELDTFLDSL
Ga0315278_1113540523300031997SedimentMAGTVKETVMPVHEETEEDIKALLEGTDAAWAQYKQGQGTRVAGTKELDAFLDSL
Ga0315289_1092052413300032046SedimentMAGTVKKTITPVREDTEEDIGTLLEGTDAAWAQYKQGKGKRITSSEELDAFLENL
Ga0315295_1067770723300032156SedimentMAGTVKKTITPVREETEEEIRTLLEGTDAAWAQYKRGQGKQVTSSEELDAFLNSI
Ga0315295_1162762313300032156SedimentGVTVTVKTNELWPIYLYEAHHFISMASTVKETVMPVHEETEEGIKALLEGTDAAWAQYKQGQGTRVAGTKELDAFLDSL
Ga0315286_1082586833300032342SedimentMAGTVKETAMPVRGETEEEIKALLMGTDVAWTQYKRDHGTRVTSAKELDTFLDGL
Ga0315287_1062309323300032397SedimentMACTVKETVMPVHEETKEDIKALLEGTDAAWAQYKQGQGTRVAGAKELDAFLDSL
Ga0315275_1269496313300032401SedimentMAGTVKETITPISEEPQEEIKALLKGTDVAWAQYKQSQGTQVTSAKELDAFLDSL
Ga0315273_1223832613300032516SedimentMPVHEETEEDIKALLEGTDAAWAQYKQGQGTRVAGAKELDAFLDSL
Ga0315273_1238218123300032516SedimentMAGTVKETVMPVHEETKEDIKALLEGTDAAWAQYKQGQGTRVAGTKELDAFLDSL
Ga0316625_10223425213300033418SoilASTVKETVMPVREEAKEDIKTLLEGTDVAWAQYKRCQGTQVTNIKELDTFLDSL
Ga0316600_1078111513300033481SoilMASTVKETVMPVREEAKEDIKTLLEGTDVAWAQYKRCQGTQVTNIKELDTFLDSL
Ga0316627_10024785413300033482SoilMAGTVKETVMPVQEETEEDIKALLEGTDAAWAQYKQGQGTRVAGTNELDAFLDSL
Ga0316616_10224494623300033521SoilMAGTVKETVMPVREEAKEDIKTLLEGTDVAWAQYKRGQGTQVTNIKELDTFLDNL
Ga0334811_051861_500_6673300033891SoilMTGTVKETVMPVREEPEEDIKALREGTDVAWTQYKQGKGTRVTSAKELDAFLDRL
Ga0370481_0295606_347_5143300034281Untreated Peat SoilMAGTVKETVMPVREEPEEDIKALLEGTDVAWTQYKQGKGTRVTSAKEFDAFLDSL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.