Metagenome / Metatranscriptome Family F102533

Overview

Basic Information

• Family ID: F102533
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 101
• Average Sequence Length: 36 residues
• Representative Sequence: MKSLVKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD
• Number of Associated Samples: 65
• Number of Associated Scaffolds: 101

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 0.99 %
• % of genes near scaffold ends (potentially truncated): 28.71 %
• % of genes from short scaffolds (< 2000 bps): 56.44 %
• Associated GOLD sequencing projects: 59
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.22

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (92.079 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil (10.891 % of family members)
• Environment Ontology (ENVO): Unclassified (20.792 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Water (non-saline) (35.644 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 25.40%
  β-sheet: 0.00%
  Coil/Unstructured: 74.60%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 101 Family Scaffolds
PF13847	Methyltransf_31	20.79
PF04055	Radical_SAM	14.85
PF00085	Thioredoxin	10.89
PF07992	Pyr_redox_2	5.94
PF13353	Fer4_12	3.96
PF03625	DUF302	3.96
PF02873	MurB_C	1.98
PF12801	Fer4_5	0.99
PF13237	Fer4_10	0.99
PF08901	DUF1847	0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 101 Family Scaffolds
COG3439	Uncharacterized conserved protein, DUF302 family	Function unknown [S]	3.96
COG0812	UDP-N-acetylenolpyruvoylglucosamine reductase	Cell wall/membrane/envelope biogenesis [M]	1.98
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.99
COG1618	Nucleoside-triphosphatase THEP1	Nucleotide transport and metabolism [F]	0.99
COG2025	Electron transfer flavoprotein, alpha subunit FixB	Energy production and conversion [C]	0.99
COG2086	Electron transfer flavoprotein, alpha and beta subunits	Energy production and conversion [C]	0.99
COG2314	Uncharacterized membrane protein YozV, TM2 domain, contains pTyr	General function prediction only [R]	0.99
COG2326	Polyphosphate kinase 2, PPK2 family	Energy production and conversion [C]	0.99
COG4887	Uncharacterized metal-binding protein MJ0455, DUF1847 family	Function unknown [S]	0.99

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.08 %
Unclassified	root	N/A	7.92 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.08 %
Unclassified	root	N/A	7.92 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.08 %
Unclassified	root	N/A	7.92 %

Level 4

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	30.69 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	16.83 %
Unclassified	root	N/A	7.92 %

Level 5

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	30.69 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	16.83 %
Unclassified	root	N/A	7.92 %

Level 6

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	30.69 %
Leptospirales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales	0.99 %
Spirochaetales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales	13.86 %
Unclassified	root	N/A	7.92 %

Level 7

Name	Rank	Taxonomy	Distribution
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	8.91 %
Chitinophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia	0.99 %
Leptospiraceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae	0.99 %
Spirochaetaceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae	11.88 %
Unclassified	root	N/A	7.92 %

Level 8

Name	Rank	Taxonomy	Distribution
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	2.97 %
Chitinophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales	0.99 %
Leptonema	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptonema	0.99 %
Salinispira	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira	9.90 %
Spirochaeta	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta	0.99 %
Unclassified	root	N/A	7.92 %

Level 9

Name	Rank	Taxonomy	Distribution
Chitinophagaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae	0.99 %
Lentimicrobiaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae	0.99 %
Leptonema illini	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptonema → Leptonema illini	0.99 %
Salinispira pacifica	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica	9.90 %
Unclassified	root	N/A	7.92 %
unclassified Spirochaeta	no rank	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta	0.99 %

Level 10

Name	Rank	Taxonomy	Distribution
Lentimicrobium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium	0.99 %
Leptonema illini	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptonema → Leptonema illini	0.99 %
Niabella	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella	0.99 %
Salinispira pacifica	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica	9.90 %
Spirochaeta sp.	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.	0.99 %
Unclassified	root	N/A	7.92 %

Level 11

Name	Rank	Taxonomy	Distribution
Lentimicrobium saccharophilum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum	0.99 %
Leptonema illini	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Leptospirales → Leptospiraceae → Leptonema → Leptonema illini	0.99 %
Niabella hibiscisoli	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niabella → Niabella hibiscisoli	0.99 %
Salinispira pacifica	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica	9.90 %
Spirochaeta sp.	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Spirochaeta → unclassified Spirochaeta → Spirochaeta sp.	0.99 %
Unclassified	root	N/A	7.92 %

Associated Scaffolds

Scaffold	Taxonomy	Length
(restricted) 3300028044|Ga0247838_1191193	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	741
(restricted) 3300028571|Ga0247844_1007262	All Organisms → cellular organisms → Bacteria	12721
(restricted) 3300028581|Ga0247840_10054018	All Organisms → cellular organisms → Bacteria	3097
(restricted) 3300028581|Ga0247840_10142392	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica	1460
(restricted) 3300029268|Ga0247842_10041450	All Organisms → cellular organisms → Bacteria	3293
(restricted) 3300029286|Ga0247841_10222100	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Salinispira → Salinispira pacifica	1368
(restricted) 3300029286|Ga0247841_10257439	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1233
3300000228|TB_PC08_66DRAFT_10001017	All Organisms → cellular organisms → Bacteria	14490
3300000228|TB_PC08_66DRAFT_10002157	All Organisms → cellular organisms → Bacteria	10195
3300001213|JGIcombinedJ13530_105693632	Not Available	622

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Engineered	Engineered	2.97%
Environmental	Environmental	96.04%
Host-Associated	Host-Associated	0.99%

Class

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	65.35%
Bioremediation	Engineered → Bioremediation	0.99%
Plants	Host-Associated → Plants	0.99%
Terrestrial	Environmental → Terrestrial	30.69%
Wastewater	Engineered → Wastewater	1.98%

Category

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	0.99%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	5.94%
Freshwater	Environmental → Aquatic → Freshwater	52.48%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.99%
Marine	Environmental → Aquatic → Marine	3.96%
Metal	Engineered → Bioremediation → Metal	0.99%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	1.98%
Peat	Environmental → Terrestrial → Peat	1.98%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.99%
Sediment	Environmental → Aquatic → Sediment	6.93%
Soil	Environmental → Terrestrial → Soil	22.77%

Type

Habitat	Taxonomy	Distribution
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	3.96%
Ice	Environmental → Aquatic → Freshwater → Ice	3.96%
Lake	Environmental → Aquatic → Freshwater → Lake	29.70%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.99%
Mine Water	Engineered → Wastewater → Industrial Wastewater → Mine Water	0.99%
Pond	Environmental → Aquatic → Freshwater → Pond	3.96%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	1.98%
Sediment	Environmental → Aquatic → Freshwater → Sediment	5.94%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.99%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	10.89%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.93%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	5.94%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.98%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	0.99%
Unclassified	Engineered → Bioremediation → Metal → Unclassified	0.99%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	11.88%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	3.96%
Wetlands	Environmental → Aquatic → Marine → Wetlands	3.96%

Subtype

Habitat	Taxonomy	Distribution
Cave Water	Environmental → Aquatic → Freshwater → Groundwater → Cave Water	1.98%
Glacial Lake	Environmental → Aquatic → Freshwater → Ice → Glacial Lake	3.96%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	0.99%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	10.89%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.98%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	5.94%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	3.96%
Sediment	Environmental → Aquatic → Freshwater → Pond → Sediment	3.96%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	3.96%
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	23.76%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	9.90%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.93%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	5.94%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	5.94%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	1.98%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	1.98%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.98%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.99%
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	0.99%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified	0.99%
Unclassified	Engineered → Bioremediation → Metal → Unclassified → Unclassified	0.99%

Habitat

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	0.99%
Anoxic Zone Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater	2.97%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	10.89%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	5.94%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	1.98%
Fen	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen	0.99%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	6.93%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	3.96%
Freshwater	Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater	3.96%
Freshwater	Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater	3.96%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater	0.99%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.99%
Freshwater Lake Hypolimnion	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion	6.93%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	1.98%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater	1.98%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	0.99%
Lake Chemocline	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline	1.98%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.99%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.99%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.99%
Saline Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water	1.98%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	3.96%
Sediment	Engineered → Wastewater → Industrial Wastewater → Mine Water → Unclassified → Sediment	0.99%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	6.93%
Sediment Slurry	Engineered → Bioremediation → Metal → Unclassified → Unclassified → Sediment Slurry	0.99%
Sinkhole Freshwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater	0.99%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	5.94%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	2.97%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	5.94%
Wetland	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland	3.96%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	3.96%

Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OID	Sample Name	Habitat Type
3300000228	Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- PC08_66	Environmental
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental
3300001809	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk Metatranscriptome (Metagenome Metatranscriptome)	Environmental
3300001868	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A	Environmental
3300002027	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1.5k-5k	Environmental
3300002066	Barrow Graham LP Ref core NGADG0002-211 (Barrow Graham LP Ref core NGADG0002-211,NGADG0004-311, ASSEMBLY_DATE=20131004)	Environmental
3300002068	Barrow Graham LP Ref core NGADG0004-212 (Barrow Graham LP Ref core NGADG0004-212,NGADG0011-311, ASSEMBLY_DATE=20131010)	Environmental
3300002101	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 11-31A	Environmental
3300002183	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A	Environmental
3300002347	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219)	Environmental

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
TB_PC08_66DRAFT_1000101713	3300000228	Groundwater	MLSNSKTKKIEIMKSLVKKKIEVQKVNTKKVAQCCAKTSKTVVGCHD*
TB_PC08_66DRAFT_100021572	3300000228	Groundwater	MKSLVKKKIEVQKVNTKKVAQCCAKTSKTVVGCHD*
JGIcombinedJ13530_1056936321	3300001213	Wetland	NVVKMKSLVKKKIMKVEAKPAQCCAKVSKTVVGCHD*
JGIcombinedJ13530_1057453212	3300001213	Wetland	MKSLVKKKERKANETAKPAQCCAKISKIIVGCHD*
JGI20220J20339_10761912	3300001809	Wetland	MKSLVKKKVKVEKAETKKEAQCCAKTSKTVVGCHD*
JGI24146J20443_10352173	3300001868	Arctic Peat Soil	MTIMKSLIKKKEGKVNAKAAQCCAKTSKIIVGCHD*
MIS_100601285	3300002027	Sinkhole Freshwater	MKSLVKKIETVKVNQEVTKKVAQCCAKTSKTIVGCHD*
JGIcombinedJ21911_100003735	3300002066	Arctic Peat Soil	MTIMKSLIKKKEGKVNAKPAQCCAKTSKIIVGCHD*
JGIcombinedJ21913_100056225	3300002068	Arctic Peat Soil	MTIMKSLIKKKEGKVNAKPAQCCATSKIIVGCHD*
JGI24146J26653_10340682	3300002101	Arctic Peat Soil	MTIMKSLIKKKEGKVNAKXAQCCAKTSKIIVGXHD*
JGI24145J26757_101447972	3300002183	Arctic Peat Soil	MTIMKSLIKKKEGKVNAKPAQCCAXTSKIIVGCHD*
JGIcombinedJ26865_10276112	3300002347	Arctic Peat Soil	MTIMKSLIKKKEGKVSAKPAQCCAKTSKIIVGCHD*
Ga0066603_105051352	3300004154	Freshwater	NKKINFMKSLVKKKVEVQKATSKKVAQCCAKTSKTVVGCHD*
Ga0066599_1003496172	3300004282	Freshwater	MKSLVKKNTGKAGVKVKASENAKPAQCCAKTSKIIVGCHD*
Ga0066599_1008182332	3300004282	Freshwater	MKSLVKKNNVKASAKANGNGNAKPAQCCAKTSKIIVGCHD*
Ga0066599_1012711562	3300004282	Freshwater	FTYKIIDMKSVIRKKEKRNNTKTAQCCAKTSKTVVGCHD*
Ga0074471_102366622	3300005831	Sediment (Intertidal)	MKTLVKKKVEAQKVNTKKVAQCCAKTSKAVVGCHD*
Ga0074471_102579742	3300005831	Sediment (Intertidal)	MKSLVKKKIEVQKVNAKKVAQCCAKTSKTVVGCHD*
Ga0074471_103513661	3300005831	Sediment (Intertidal)	SNSINQTYMTSLIKKKKVEVEAKVAQCCAKTSKNVVGCHD*
Ga0074471_104608282	3300005831	Sediment (Intertidal)	MSYEKSDQKKIEKENVKVAQCCAKTSKTVAGCHD*
Ga0074471_104812572	3300005831	Sediment (Intertidal)	MKTLVKKKIEAQKINTKKVAQCCAKTSKTVVGCHD*
Ga0074471_105640111	3300005831	Sediment (Intertidal)	TTMKSLIKKKDGKVNTKVAQCCAKTSKTVVGCHD*
Ga0074471_106325902	3300005831	Sediment (Intertidal)	THMKSLIKKKVEVQKTNTKKVAQCCAKTSKTVVGCHD*
Ga0079306_100080317	3300007959	Deep Subsurface	MKSLVKKKIEVQKVNTKKVAQCCAKTSKTIVGCHD*
Ga0079306_10012005	3300007959	Deep Subsurface	MKSLVKKKMEVQKVNTKKTAQCCAKTSKTVVGCHD*
Ga0079306_11691762	3300007959	Deep Subsurface	MKSLVKKKIEVQKVNTKKVAQCCAKTSTTVVGCHD*
Ga0066793_100053189	3300009029	Prmafrost Soil	MTIMKTLIKKKEGKVNAKPAQCCAKTSKIIVGCHD*
Ga0105047_100025482	3300009083	Freshwater	MKSLIKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0105047_101310883	3300009083	Freshwater	MKTLVKKKVETQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0115026_113714052	3300009111	Wetland	MKSLVKKKEGKVKANENAKPAQCCAKTSKIIVGCHD*
Ga0115027_100702105	3300009131	Wetland	MKSLVKKKIEIQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0115027_104051211	3300009131	Wetland	IETMKNLVKKKVKVEKANEKKEAQCCAKTSKTVVGCHD*
Ga0114977_100574182	3300009158	Freshwater Lake	MKTLVKKKIENQKTNTKKVAQCCAKTSKAVVGCHD*
Ga0073936_100310631	3300009175	Freshwater Lake Hypolimnion	YNTMKCLVKKQNEKEPIKKVAQCCAKTSKTIVGCHD*
Ga0073936_100561392	3300009175	Freshwater Lake Hypolimnion	MKSLIKKKVKVQKAETKKVAQCCAKTSKTIVGCHD*
Ga0114951_100022046	3300009502	Freshwater	MIMKTLIKKKVQKAVEKKPAQCCAKTSKVVAGCHD*
Ga0114951_1000355318	3300009502	Freshwater	MKSLVKKKVKAPKAETKKVAQCCAKTSKTIVGCHD*
Ga0114951_101329144	3300009502	Freshwater	QQRLINYFFMKSLIKKKEPKKVEVAQCCAKTSRTVVGCHD*
Ga0115592_11049662	3300009755	Wetland	KSLVKKKEGKEKANENAKPAQCCAKTSKIIVGCHD*
Ga0115595_10631541	3300010138	Wetland	LKIETMKSLIKKKIKVEKETAKKEAQCCAKTSKTVVGCHD*
Ga0116245_100984632	3300010338	Anaerobic Digestor Sludge	MKSLIKIKQPTKKQSPKKAQCCAKLSKTTVGCHD*
Ga0138308_10003062	3300010965	Lake Chemocline	MKTLVKKKIETQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0138308_10132916	3300010965	Lake Chemocline	MKSLVKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD*
Ga0151652_100686432	3300011340	Wetland	MKSLFKKKERKANETAKPAQCCAKISKIIVGCHD*
Ga0151652_127417782	3300011340	Wetland	MKSLIKKKIKVEKENAKKEAQCCAKTSKTVVGCHD*
Ga0151652_137531822	3300011340	Wetland	KIQTMKSLVKKKVKAPKAETKKVAQCCAKTSKTIVGCHD*
Ga0173609_105783571	3300013315	Sediment	IPVIMKSLIKKKESKVNAKPAQCCAKTSKIIVGCHD*
Ga0075315_10125172	3300014258	Natural And Restored Wetlands	VLLIFKIDFMKSLVKRKEKKLKTKEAQCCAKTSKNVAGCHD*
Ga0182027_103091691	3300014839	Fen	NKFNITHSKKLSMKSLVKKKEISSNTKTAQCCAKTSKTIVGCHD*
Ga0207193_100233527	3300020048	Freshwater Lake Sediment	MKTLVKKKIENQKTNTKKVAQCCAKTSKAVVGCHD
Ga0207193_10203925	3300020048	Freshwater Lake Sediment	MKSLIKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD
Ga0194039_10022569	3300020163	Anoxic Zone Freshwater	MKSLVKKKIKIEKANSKKVAQCCAKTSKTIVGCHD
Ga0214167_10555762	3300021136	Freshwater	VITITQKLIFMKSLIKKKEEPKAVKIAQCCAKTSRTVVGCHD
Ga0194053_100157564	3300021520	Anoxic Zone Freshwater	MKSLVKKKIKVEKASTKKVAQCCAKTSKTIVGCHD
Ga0194053_100654002	3300021520	Anoxic Zone Freshwater	TKISTMKSLVKKKVKVEKVNTKKVAQCCAKTSKTVMGCHD
Ga0212088_1000277119	3300022555	Freshwater Lake Hypolimnion	MKSLVKKKTNVEKANTKKTAQCCAKTSKTIVGCHD
Ga0212088_100254706	3300022555	Freshwater Lake Hypolimnion	MIMKTLIKKKVQKAVEKKPAQCCAKTSKVVAGCHD
Ga0212088_100600324	3300022555	Freshwater Lake Hypolimnion	MKSLVKKKVKAPKAETKKVAQCCAKTSKTIVGCHD
Ga0212088_100724645	3300022555	Freshwater Lake Hypolimnion	NQILTIKTETMKSLIKKKVKVQKAETKKVAQCCAKTSKTIVGCHD
Ga0212088_102420901	3300022555	Freshwater Lake Hypolimnion	FPKYKRGKAIQQRLINYFFMKSLIKKKEPKKVEVAQCCAKTSRTVVGCHD
Ga0209083_10240742	3300025162	Freshwater	MKSLVKKKTEIETANSKKVAQCCAKTSATIVGCHD
Ga0208584_11518031	3300025533	Arctic Peat Soil	MTIMKSLIKKKEGKVNAKPAQCCAKTSKIIVGCHD
Ga0209744_12384722	3300025692	Arctic Peat Soil	MTIMKSLIKKKEGKVNAKAAQCCAKTSKIIVGCHD
Ga0209123_10237143	3300025718	Arctic Peat Soil	MKTLVKKKIEIQKVNTQKVAQCCAKTSKTVVGCHD
Ga0209748_11974662	3300025836	Arctic Peat Soil	MSIMKSLIKKKEVKVSVKPAQCCAKTSKTIVGCHD
Ga0209226_104067312	3300025865	Arctic Peat Soil	MTNMKSLIKKKEGKVNAKAAQCCTKTSKIIVGCHD
Ga0208789_100005865	3300027265	Deep Subsurface	MKSLVKKKMEVQKVNTKKTAQCCAKTSKTVVGCHD
Ga0208789_100141314	3300027265	Deep Subsurface	MKSLVKKKIEVQKVNTKKVAQCCAKTSKTIVGCHD
Ga0208789_10043032	3300027265	Deep Subsurface	MKSLVKKKIEVQKVNTKKVAQCCAKTSTTVVGCHD
Ga0209397_100842212	3300027871	Wetland	LKIETMKSLVKKKVKVEKANTKKEAQCCAKTSKAVVGCHD
Ga0208980_100936122	3300027887	Wetland	MKSLIKKKIKVEKENAKKEAQCCAKTSKTTVGCHD
Ga0208980_102390762	3300027887	Wetland	MKSLVKKKIKVEKENAKKEAQCCAKSSKTVVGCHD
Ga0265296_12001422	3300028032	Groundwater	LLIFKFEFMKSLVKKKTQKTSTKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247838_11911932	3300028044	Freshwater	TMKSLIKKKVKVEKVNSKKVAQCCAKTSKTIVGCHD
Ga0268284_100154314	3300028176	Saline Water	MKSLVKKKVKVQKADTKKVAQCCAKTSKTIVGCHD
Ga0265593_100207211	3300028178	Saline Water	MKSLVKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD
(restricted) Ga0247844_10072629	3300028571	Freshwater	MKSLIKKKVKVEKVNSKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247840_100540186	3300028581	Freshwater	MKSLVKKKVKVEKVSTKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247840_101423922	3300028581	Freshwater	MKSLIKKKIKVEKANSKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247842_100414504	3300029268	Freshwater	MKSLVKKKVKVEKVNTKKVAQCCAKTSKTIVGCHD
(restricted) Ga0247841_102221002	3300029286	Freshwater	MKTLVKKTVKVEKISTKSSAQCCAKTSKNVPGCHD
(restricted) Ga0247841_102574392	3300029286	Freshwater	MKSLVKKKIKVEKENAKKEAQCCAKTSKTVVGCHD
Ga0265327_1000136118	3300031251	Rhizosphere	MKSLVKKKTKEKTETKTKTALCCAKTSKAIPGCHD
Ga0311364_119883482	3300031521	Fen	MKSLVKKKLEAQKVNTKKVAQCCAKTSKTVVGCHD
Ga0302322_1001667501	3300031902	Fen	LTQSKFRIMKSLIKKKETRTIVKVAQCCAKTSKTVVGCHD
Ga0315268_1000555313	3300032173	Sediment	MKSLIKKKVETQKVNTKKVAQCCAKTSKTVVGCHD
Ga0315270_100066259	3300032275	Sediment	MKSLVKKKIETQKVNTPKVAQCCAKTSKTVVGCHD
Ga0315270_100359052	3300032275	Sediment	MKTLVKKKIEAQKINTKKVAQCCAKTSKTVVGCHD
Ga0315270_100619314	3300032275	Sediment	MKSLVKKKIEVQKVDTKKVAQCCAKTSKTVVGCHD
Ga0335397_102185891	3300032420	Freshwater	IFNMKTLVKKKVETQKVNTKKVAQCCAKTSKTVVGCHD
Ga0335397_102713694	3300032420	Freshwater	MKTLVKKKVETQKVNTKKVAQCCAKTSKTVVGCHD
Ga0316619_113035241	3300033414	Soil	YLNKIMKSVIKKKETRKQIKTAQCCAKTSKTVVGCHD
Ga0316625_1009081662	3300033418	Soil	MKSLVKKKVKVEKANEKKEAQCCAKSSKTVVGCHD
Ga0316624_117540941	3300033486	Soil	YFKSQITIMKSLIKNKANKVKAKVAQCCAKISKTIAGCHD
Ga0316616_1012454202	3300033521	Soil	MKSLVKKKIEVQKVNTQKVAQCCAKTSKTVVGCHD
Ga0316616_1017988132	3300033521	Soil	MKSLVKKKVKVEKANEKKEAQCCAKTSKTVVGCHD
Ga0316616_1020924452	3300033521	Soil	MKSLVKKKIEVKKESAKKTAQCCAKTSKTVVGCHD
Ga0373912_0092525_198_305	3300034088	Sediment Slurry	MKSLVKKKTEVQKVNTKKVAQCCAKTSKTVVGCHD
Ga0370479_0092500_676_792	3300034123	Untreated Peat Soil	IKLLKIMKSLIKKKAERVTAKPAQCCAKTSKTIVGCHD
Ga0370490_0048671_371_478	3300034128	Untreated Peat Soil	MKSLIKKKIKVEKENAKKEAQCCAKTSKNVVGCHD
Ga0370503_0296675_2_124	3300034196	Untreated Peat Soil	TKIEIIKSLLKKKVEVQKVNTKKVAQCCAKTSKTVVGCHD