Basic Information | |
---|---|
Family ID | F102094 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 47 residues |
Representative Sequence | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKQPHA |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 0.98 % |
% of genes from short scaffolds (< 2000 bps) | 0.98 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.46 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (99.020 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (14.706 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.314 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.843 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 12.33% β-sheet: 30.14% Coil/Unstructured: 57.53% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF04392 | ABC_sub_bind | 22.55 |
PF00216 | Bac_DNA_binding | 5.88 |
PF02110 | HK | 2.94 |
PF07885 | Ion_trans_2 | 1.96 |
PF11737 | DUF3300 | 1.96 |
PF07976 | Phe_hydrox_dim | 1.96 |
PF00072 | Response_reg | 0.98 |
PF00106 | adh_short | 0.98 |
PF03976 | PPK2 | 0.98 |
PF03729 | DUF308 | 0.98 |
PF01037 | AsnC_trans_reg | 0.98 |
PF02566 | OsmC | 0.98 |
PF00685 | Sulfotransfer_1 | 0.98 |
PF12821 | ThrE_2 | 0.98 |
PF08543 | Phos_pyr_kin | 0.98 |
PF02581 | TMP-TENI | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 22.55 |
COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 5.88 |
COG0063 | NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain | Nucleotide transport and metabolism [F] | 2.94 |
COG2145 | Hydroxyethylthiazole kinase, sugar kinase family | Coenzyme transport and metabolism [H] | 2.94 |
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.98 |
COG0352 | Thiamine monophosphate synthase | Coenzyme transport and metabolism [H] | 0.98 |
COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.98 |
COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.98 |
COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.98 |
COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.98 |
COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.98 |
COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 99.02 % |
All Organisms | root | All Organisms | 0.98 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300032174|Ga0307470_10225587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 14.71% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 12.75% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 5.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.94% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.98% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.98% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.98% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.98% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.98% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.98% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.98% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001433 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Environmental | Open in IMG/M |
3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
3300003321 | Sugarcane bulk soil Sample H1 | Environmental | Open in IMG/M |
3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Host-Associated | Open in IMG/M |
3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Host-Associated | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026741 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-SCHO21-C (SPAdes) | Environmental | Open in IMG/M |
3300026807 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-11 (SPAdes) | Environmental | Open in IMG/M |
3300026939 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A5-12 (SPAdes) | Environmental | Open in IMG/M |
3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
3300027425 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-10 (SPAdes) | Environmental | Open in IMG/M |
3300027431 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A1a-11 (SPAdes) | Environmental | Open in IMG/M |
3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10214J12806_115332212 | 3300000891 | Soil | MYVLIIVIGVLSQGASIVPVGVTSQIVGKFKNLDE |
JGI24036J14985_1031451 | 3300001433 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKQPHAAGPIADITVV |
JGI24750J21931_10502682 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAA |
JGI24742J22300_100643002 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNXDECKAAA |
soilH1_102431462 | 3300003321 | Sugarcane Root And Bulk Soil | MYALIIVIGMVSPGAAVTPVGATGQIVGKFKTLDRCKESRK* |
JGI26129J50193_10165151 | 3300003349 | Arabidopsis Thaliana Rhizosphere | MYVLIIVIGVLSQGASIVPVGVTSQVVGKFKNLDECKAAAKQPH |
Ga0058860_121665652 | 3300004801 | Host-Associated | LIIVIGVLSSDKPAGSAVSIGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS* |
Ga0066823_100896002 | 3300005163 | Soil | MYALIIVIGVISSGSSVIPVGVTSQIVGKFKNLDECKAAASQPHAGGPVADI |
Ga0066869_100465921 | 3300005165 | Soil | MYALIMVIGMLSPATSAVVPVGVTSQIVGKFKTKDECEAAASRPVAGGTISDLSL |
Ga0066810_100632611 | 3300005169 | Soil | MYALIIVIGMLSQGAGSAVMPVGVTSQIVGKFKNLDECKAAASQPHA |
Ga0065712_100916593 | 3300005290 | Miscanthus Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS* |
Ga0070676_105732821 | 3300005328 | Miscanthus Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAK |
Ga0070676_109219502 | 3300005328 | Miscanthus Rhizosphere | MRRLSDVLIIVIGVLSQGASIVPVGVTSQIVRKFKNLDECKA |
Ga0068869_1000269271 | 3300005334 | Miscanthus Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAA |
Ga0070682_1001464383 | 3300005337 | Corn Rhizosphere | MYALIIVIGMLSQGAGSAVMPVGVTSQIVGKFKNLDECKTAASQPHAGGPV |
Ga0070660_1001983132 | 3300005339 | Corn Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKQPH |
Ga0070691_108345611 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALIIVIGMLSQGAAGSAVIPVGVTSQIVGKFKNLDECKAAASQPHAGGPV |
Ga0070691_110191661 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | IGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS* |
Ga0070703_100043386 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAK |
Ga0070710_104388163 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLIIVIGVLSQGASIMPIGVTSQIVGKFKNLDECQAAAKQPHAA |
Ga0070711_1003197491 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MYTLIIVIGVLSQGASIMPIGVTSQIVGKFKNLDECQAAAKQPHAAG |
Ga0070711_1005464041 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALIIVIGMLSQGAAGSAVIPVGVTSQIVGKFNNLDEYKAAASQPHAGGPVSDL |
Ga0070705_1006828952 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALIIVIGVLSSGSPGLGIPIGVTSQIVGNFKTLDECKAAASEP |
Ga0070700_1001207393 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKQPHAAGP |
Ga0070694_1012772242 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALIIVIGVLSPGSPGLGIPIGVTSQIVGKFQTLDECKAAASEPYATG |
Ga0070662_1000347766 | 3300005457 | Corn Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKQPHAAGPI |
Ga0070681_108921451 | 3300005458 | Corn Rhizosphere | MRRLSDVLIIVIGVLSQGASIVPVGVTSQVVGKFKNLDECKAAA |
Ga0070681_118828751 | 3300005458 | Corn Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKQPHAAGPIADITV |
Ga0070679_1000536426 | 3300005530 | Corn Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKQ |
Ga0070704_1003365131 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKQPHAAGPIADITV |
Ga0070664_1002407791 | 3300005564 | Corn Rhizosphere | MYALIIVIGMLSQGASSAVMPVGVTSQIVGKFENLDQ* |
Ga0068858_1002764701 | 3300005842 | Switchgrass Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKQPHAAGPIA |
Ga0075023_1001145721 | 3300006041 | Watersheds | MYALIIVIGVLSSGSSVVPIGVTSQIVGKFKNLDECKAAASQPHAAGPVADI |
Ga0105243_116317281 | 3300009148 | Miscanthus Rhizosphere | MYALIIVIGMLSQGAAGSAVIPVGVTSQIVGKFKN |
Ga0105248_110348471 | 3300009177 | Switchgrass Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAATKHPTPQVLLRISLS* |
Ga0105238_105535963 | 3300009551 | Corn Rhizosphere | MYALIIVIGMLSQGAGSAVMPVGVTSQIVGKFKNLDECKTAASQ |
Ga0134126_101449871 | 3300010396 | Terrestrial Soil | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS* |
Ga0157319_10102712 | 3300012497 | Arabidopsis Rhizosphere | MYVLIIVIGVLSQGASIVPVGVTSQVVGKFKNLDECKAAAKQ |
Ga0137398_108882411 | 3300012683 | Vadose Zone Soil | MYALIIIIGMSGVSGGVTSQIVGKFKSLDECKAAASQPHAGGPIADLGLSATWG |
Ga0157308_102637631 | 3300012910 | Soil | MYALIIVIGVLSSDKPAGSAVSIGVTSQIVGKFKNLDECKAAASQPHATAPAED |
Ga0164300_100325503 | 3300012951 | Soil | MYMLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS* |
Ga0164303_100235781 | 3300012957 | Soil | ITGGLAMYALIIVIGMLSQGASSAVMPVGVTSQIVGKFENLDQ* |
Ga0164299_100252715 | 3300012958 | Soil | MYALIIVIGMLSQGAGSAVMPVGVTSQIVGKFKNLDECKAAASQPHAGGPIS |
Ga0164299_102768101 | 3300012958 | Soil | MYVLIIVIGVLSQGASIVPVGVTSQIVGKFKNLDECK |
Ga0164299_104503152 | 3300012958 | Soil | MYALIIVIGVLSSGSPGLGIPIGVTSQIVGNFKTLDECKAA |
Ga0164307_101072711 | 3300012987 | Soil | MYALIIVIGMLSQGAGSAVMPVGVTSQIVGKFKNLDECKTAASQPHA |
Ga0164306_100536131 | 3300012988 | Soil | MYALIIVIGMLSQGAGSAVMPVGVTSQIVGKFKNLDECKTA |
Ga0157307_10185051 | 3300013096 | Soil | MRRLSDVLIIVIGVLSQGASIVPVGVTSQIVGKFKN |
Ga0157307_10736311 | 3300013096 | Soil | ILTKSLFAGCTTLGGSAMYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS* |
Ga0157375_101393891 | 3300013308 | Miscanthus Rhizosphere | HTIICYKATTGGLAMYALIIVIGMLSQGASSAVMPVGVTSQIVGKFENLDQ* |
Ga0157380_127021732 | 3300014326 | Switchgrass Rhizosphere | MYRLIIVIGMLSPATGSVVPVGVTSQVVGKFESLEQCKAAASQPGAGGTISEL |
Ga0157377_103485232 | 3300014745 | Miscanthus Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKQPHA |
Ga0157379_113546561 | 3300014968 | Switchgrass Rhizosphere | MYMLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKA |
Ga0182039_114396502 | 3300016422 | Soil | MYTLIIVIGMLSPPSTTGSVTPLGVTSQIVGKFKSLD |
Ga0184608_103205262 | 3300018028 | Groundwater Sediment | MYALIIVIGVLSSGSSVIPVGVTPQLIGKFKNLDDCKAAASQPHAGGTIPDFNFPTTGAN |
Ga0173481_103562611 | 3300019356 | Soil | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS |
Ga0222622_108612732 | 3300022756 | Groundwater Sediment | MYALIIVIGVLSSGSSVIPVGVTPQLIGKFKNLDECKAAASQPHAGGTIPDFNFPTTGAN |
Ga0247792_10010557 | 3300022880 | Soil | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKQPHAAG |
Ga0247798_10666761 | 3300023260 | Soil | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDE |
Ga0247800_10064811 | 3300023263 | Soil | MYVLIIVIGVLSQGASIVPVGVTSQVVGKFKNLDEC |
Ga0207653_100052461 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAATK |
Ga0207682_100801552 | 3300025893 | Miscanthus Rhizosphere | MYTLIIVIGMLSPATGSVVPVGVTSQVVGKFESLEQCKAAASQPG |
Ga0207685_100871893 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALIIVIGMLSQGAAGSAVIPVGVTSQIVGKFKNLDECKAAASQPHAGGPVSDLSLS |
Ga0207643_1000056824 | 3300025908 | Miscanthus Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRIS |
Ga0207707_103165913 | 3300025912 | Corn Rhizosphere | MYALIIVIGMLSQGAAGSAVIPVGVTSQIVGKFKNLDECKAAASQPHAG |
Ga0207693_111467561 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MYALIIVIGMLSPTTSLAAGVTSQIVGKFEDLDQCRAA |
Ga0207687_1000260713 | 3300025927 | Miscanthus Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKQPHAAGP |
Ga0207670_104703022 | 3300025936 | Switchgrass Rhizosphere | GGSAMYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS |
Ga0207669_102971831 | 3300025937 | Miscanthus Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKQPHAA |
Ga0207711_102444401 | 3300025941 | Switchgrass Rhizosphere | MYALIIVIGMLSQGAAGSAVIPVGVTSQIVGKFKNLDECKAA |
Ga0207711_121164101 | 3300025941 | Switchgrass Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFENLDQ |
Ga0207661_109059552 | 3300025944 | Corn Rhizosphere | MYALIIVIGMLSQGAAGSAVIPVGVTSQIVGKFKNLDEYKAAA |
Ga0207667_111949941 | 3300025949 | Corn Rhizosphere | MYALIIVIGMLSQGAGSAVMPVGVTSQIVGKFKNLDECKTAASQPHAGGP |
Ga0207651_100084905 | 3300025960 | Switchgrass Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKQPHAAGPIADSLS |
Ga0207712_116312221 | 3300025961 | Switchgrass Rhizosphere | VLIIVIGVLSQGASIVPVGVTSQIVRKFKNLDECK |
Ga0207658_107061801 | 3300025986 | Switchgrass Rhizosphere | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKQPHAA |
Ga0207658_109443121 | 3300025986 | Switchgrass Rhizosphere | MYALIIVIGMLSQGAAGSAVIPVGVTSQIVGKFKNLDECKAAASQP |
Ga0207703_1000558512 | 3300026035 | Switchgrass Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQ |
Ga0207648_102807361 | 3300026089 | Miscanthus Rhizosphere | MYVLIIVIGVLSQGASIVPVGVTSQIVGKFKNLDECKAAAKQPHAAGPVADITVV |
Ga0207510_1043511 | 3300026741 | Soil | MYVLIIVIGVLSQGASIVPVGVTSQVVGKFKNLDECKAAAKQPHAAGPIAD |
Ga0207547_1008561 | 3300026807 | Soil | TLGGSAMYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS |
Ga0207542_1003841 | 3300026939 | Soil | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKQPHA |
Ga0208525_10066413 | 3300027288 | Soil | MYALIIVIGVISSGSSVIPVGVTSQIVGKFKNLDECKAAASQPHAGGPVADITL |
Ga0207522_1022031 | 3300027425 | Soil | MYVLIIVIGVLSQGASIVPVGVTSQVVGKFKNLDECKAAAKHPTPQVLLRISLS |
Ga0207437_1008782 | 3300027431 | Soil | MYVLIIVIGVLSQGASIVPVGVTSQVVGKFKNLDECKAAAKQPHAA |
Ga0210002_10075351 | 3300027617 | Arabidopsis Thaliana Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDEC |
Ga0209974_101924771 | 3300027876 | Arabidopsis Thaliana Rhizosphere | MYVLIIVIGVLSQGASIVPVGVTSQIVGKFKNLDECKAAAKQPHAAGPVADIT |
Ga0207428_104549881 | 3300027907 | Populus Rhizosphere | MYMLIVVIGVLSQGASVLPVGVTSQIVGKFKNLDECKAAAKHPTPQVL |
Ga0209583_100375591 | 3300027910 | Watersheds | MYALIIVIGVLSSGSSVVPIGVTSQIVGKFKNLDE |
Ga0268265_109233163 | 3300028380 | Switchgrass Rhizosphere | MYTLIIVIGMLSPATGSVVPVGVTSQVVGKFESLEQCKAAASQPGAGGTISELNL |
Ga0307299_102273911 | 3300028793 | Soil | MYALIIVIGVLSSGSSVIPVGVTPQLIGKFKNLDECKAAASQPHAGGTIPDFNFPTT |
Ga0307287_103614241 | 3300028796 | Soil | MYTLIIVIGMSGVSGGVTSQIVGKFRNLDDCKSAASQPHAAGT |
Ga0307292_103092791 | 3300028811 | Soil | MYALIVVIAVLGGTVTPVGVGSQVVGKFKNLDQCKAAASQPSAGGAISDLGL |
Ga0170834_1136830011 | 3300031057 | Forest Soil | MYALIIVIGVLSSGSSVVPIGVTSQIVGKFKNLEECKAAASQP |
Ga0307497_102813031 | 3300031226 | Soil | MYALITVIGVLSSGSSVIPVGVTSQLVGKFKTLDDCKAAASQPHAGGTIPDFNF |
Ga0170824_1083623462 | 3300031231 | Forest Soil | MYALIIVIGVLSTGSSVIPVGVTSQIVGKFKNLDECKAAASQPHA |
Ga0170818_1075637872 | 3300031474 | Forest Soil | MYALIIVIGVLSTGSSVIPVGVTSQIVGKFKNLDECKAAASQPHAAGPVADIT |
Ga0170818_1129345511 | 3300031474 | Forest Soil | MYALIIVIGVLSSGSSVVPIGVTSQIVGKFKNLDECKAAASQPHAAGPVADIT |
Ga0310888_101578491 | 3300031538 | Soil | MYVLIVVIGVLSQGASVVPVGVTSQIVGKFKNLDECKAAAKHPTPQVLLRISLS |
Ga0306923_110994932 | 3300031910 | Soil | MYALIIVIGMLSPNTSIAAGVTSQIVGKFENLDQC |
Ga0310902_110993051 | 3300032012 | Soil | MYALIVVIGMLSPATGSVVPVGVTSQIVGKFENLDQCKAAGSQPMAGGTI |
Ga0307470_102255875 | 3300032174 | Hardwood Forest Soil | MYALIIVIGVMSSAIPVGVTSQTVGKFESLDKCKAAASEPQAGGAVLDLN |
⦗Top⦘ |