Basic Information | |
---|---|
Family ID | F094378 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 106 |
Average Sequence Length | 42 residues |
Representative Sequence | WRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNQTEGV |
Number of Associated Samples | 78 |
Number of Associated Scaffolds | 106 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 10.38 % |
% of genes near scaffold ends (potentially truncated) | 92.45 % |
% of genes from short scaffolds (< 2000 bps) | 78.30 % |
Associated GOLD sequencing projects | 73 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (57.547 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (33.019 % of family members) |
Environment Ontology (ENVO) | Unclassified (75.472 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.792 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.94% β-sheet: 0.00% Coil/Unstructured: 84.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 106 Family Scaffolds |
---|---|---|
PF01571 | GCV_T | 50.00 |
PF08669 | GCV_T_C | 17.92 |
PF02347 | GDC-P | 11.32 |
PF01597 | GCV_H | 8.49 |
PF00892 | EamA | 4.72 |
PF03255 | ACCA | 1.89 |
PF00106 | adh_short | 0.94 |
PF01274 | Malate_synthase | 0.94 |
PF01266 | DAO | 0.94 |
PF07690 | MFS_1 | 0.94 |
PF00571 | CBS | 0.94 |
COG ID | Name | Functional Category | % Frequency in 106 Family Scaffolds |
---|---|---|---|
COG0403 | Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain | Amino acid transport and metabolism [E] | 11.32 |
COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 11.32 |
COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 8.49 |
COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 1.89 |
COG2225 | Malate synthase | Energy production and conversion [C] | 0.94 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 57.55 % |
All Organisms | root | All Organisms | 42.45 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000163|LPjun09P162000mDRAFT_c1022800 | Not Available | 975 | Open in IMG/M |
3300000323|LPaug09P202000mDRAFT_1006051 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2472 | Open in IMG/M |
3300001006|JGI12027J13101_100912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1403 | Open in IMG/M |
3300001676|TuiMalila_1003394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 5131 | Open in IMG/M |
3300001676|TuiMalila_1023789 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1446 | Open in IMG/M |
3300001679|TahiMoana_1027414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3036 | Open in IMG/M |
3300005402|Ga0066855_10096259 | Not Available | 927 | Open in IMG/M |
3300005404|Ga0066856_10401103 | Not Available | 587 | Open in IMG/M |
3300005427|Ga0066851_10085747 | Not Available | 1034 | Open in IMG/M |
3300005429|Ga0066846_10287398 | Not Available | 535 | Open in IMG/M |
3300005429|Ga0066846_10295767 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 526 | Open in IMG/M |
3300005595|Ga0066833_10231611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 508 | Open in IMG/M |
3300005596|Ga0066834_10042174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1555 | Open in IMG/M |
3300005605|Ga0066850_10294084 | Not Available | 573 | Open in IMG/M |
3300005605|Ga0066850_10357019 | Not Available | 510 | Open in IMG/M |
3300005753|Ga0077776_1047943 | Not Available | 4665 | Open in IMG/M |
3300005945|Ga0066381_10186864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 595 | Open in IMG/M |
3300006012|Ga0066374_10226448 | Not Available | 548 | Open in IMG/M |
3300006079|Ga0081601_1008189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3388 | Open in IMG/M |
3300006166|Ga0066836_10321625 | Not Available | 928 | Open in IMG/M |
3300006166|Ga0066836_10395669 | Not Available | 832 | Open in IMG/M |
3300006166|Ga0066836_10581884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 678 | Open in IMG/M |
3300006166|Ga0066836_10624310 | Not Available | 652 | Open in IMG/M |
3300006166|Ga0066836_10786052 | Not Available | 575 | Open in IMG/M |
3300006313|Ga0068472_10235999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4833 | Open in IMG/M |
3300006313|Ga0068472_10665334 | Not Available | 647 | Open in IMG/M |
3300006315|Ga0068487_1393260 | Not Available | 703 | Open in IMG/M |
3300006330|Ga0068483_1484917 | Not Available | 741 | Open in IMG/M |
3300006331|Ga0068488_1375830 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 504 | Open in IMG/M |
3300006331|Ga0068488_1399959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1485 | Open in IMG/M |
3300006341|Ga0068493_10681073 | Not Available | 501 | Open in IMG/M |
3300007283|Ga0066366_10086470 | Not Available | 1186 | Open in IMG/M |
3300007509|Ga0105012_1167415 | Not Available | 776 | Open in IMG/M |
3300007512|Ga0105016_1147486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae | 1253 | Open in IMG/M |
3300008097|Ga0111541_10560709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 506 | Open in IMG/M |
3300008629|Ga0115658_1011654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 7362 | Open in IMG/M |
3300008735|Ga0115657_1080591 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2118 | Open in IMG/M |
3300008735|Ga0115657_1108612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1679 | Open in IMG/M |
3300009103|Ga0117901_1189758 | Not Available | 1110 | Open in IMG/M |
3300009104|Ga0117902_1191060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2045 | Open in IMG/M |
3300009104|Ga0117902_1308200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1461 | Open in IMG/M |
3300009109|Ga0117922_1041003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2797 | Open in IMG/M |
3300009110|Ga0117925_1066639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1438 | Open in IMG/M |
3300009376|Ga0118722_1270739 | Not Available | 973 | Open in IMG/M |
3300009376|Ga0118722_1364839 | Not Available | 733 | Open in IMG/M |
3300009376|Ga0118722_1396410 | Not Available | 650 | Open in IMG/M |
3300009409|Ga0114993_10099726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2285 | Open in IMG/M |
3300009409|Ga0114993_10335192 | Not Available | 1146 | Open in IMG/M |
3300009409|Ga0114993_10706221 | Not Available | 734 | Open in IMG/M |
3300009420|Ga0114994_10977069 | Not Available | 548 | Open in IMG/M |
3300009593|Ga0115011_11559802 | Not Available | 586 | Open in IMG/M |
3300009703|Ga0114933_10788398 | Not Available | 606 | Open in IMG/M |
3300009706|Ga0115002_10009681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 10467 | Open in IMG/M |
3300010883|Ga0133547_10809188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1839 | Open in IMG/M |
3300011312|Ga0138349_1006543 | Not Available | 788 | Open in IMG/M |
3300012950|Ga0163108_10535061 | Not Available | 757 | Open in IMG/M |
3300012950|Ga0163108_10798166 | Not Available | 610 | Open in IMG/M |
3300012950|Ga0163108_10966968 | Not Available | 550 | Open in IMG/M |
3300020263|Ga0211679_1037056 | Not Available | 894 | Open in IMG/M |
3300020268|Ga0211495_1027143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 1184 | Open in IMG/M |
3300020275|Ga0211562_1044309 | Not Available | 998 | Open in IMG/M |
3300020277|Ga0211568_1026720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1353 | Open in IMG/M |
3300020322|Ga0211563_1049431 | Not Available | 928 | Open in IMG/M |
3300020344|Ga0211570_1011008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2928 | Open in IMG/M |
3300020344|Ga0211570_1011817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2785 | Open in IMG/M |
3300020357|Ga0211611_1086173 | Not Available | 749 | Open in IMG/M |
3300020373|Ga0211660_10067029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1462 | Open in IMG/M |
3300020411|Ga0211587_10098279 | Not Available | 1273 | Open in IMG/M |
3300020411|Ga0211587_10112507 | Not Available | 1174 | Open in IMG/M |
3300020462|Ga0211546_10285574 | Not Available | 824 | Open in IMG/M |
3300020462|Ga0211546_10540517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 588 | Open in IMG/M |
3300020477|Ga0211585_10078240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2324 | Open in IMG/M |
3300020477|Ga0211585_10083380 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2229 | Open in IMG/M |
3300020477|Ga0211585_10205698 | Not Available | 1239 | Open in IMG/M |
3300020478|Ga0211503_10035499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 3193 | Open in IMG/M |
3300020478|Ga0211503_10040319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2963 | Open in IMG/M |
3300020478|Ga0211503_10287440 | Not Available | 901 | Open in IMG/M |
3300020478|Ga0211503_10352156 | Not Available | 796 | Open in IMG/M |
3300020478|Ga0211503_10553793 | Not Available | 603 | Open in IMG/M |
3300021084|Ga0206678_10306615 | Not Available | 763 | Open in IMG/M |
3300022227|Ga0187827_10041775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 3795 | Open in IMG/M |
3300025191|Ga0207921_103246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2651 | Open in IMG/M |
3300025196|Ga0207918_105497 | Not Available | 1621 | Open in IMG/M |
3300025196|Ga0207918_134418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 533 | Open in IMG/M |
3300025198|Ga0208059_1018713 | Not Available | 757 | Open in IMG/M |
3300025210|Ga0208058_1016028 | Not Available | 1059 | Open in IMG/M |
3300025215|Ga0207920_1040188 | Not Available | 736 | Open in IMG/M |
3300025243|Ga0208335_1016977 | Not Available | 1203 | Open in IMG/M |
3300026208|Ga0208640_1094672 | Not Available | 639 | Open in IMG/M |
3300026254|Ga0208522_1068013 | Not Available | 1051 | Open in IMG/M |
3300026263|Ga0207992_1151766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 579 | Open in IMG/M |
3300026265|Ga0208765_1168668 | Not Available | 519 | Open in IMG/M |
3300026269|Ga0208766_1017315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2739 | Open in IMG/M |
3300026279|Ga0208411_1007791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 4997 | Open in IMG/M |
3300026321|Ga0208764_10167247 | Not Available | 1103 | Open in IMG/M |
3300027838|Ga0209089_10464608 | Not Available | 689 | Open in IMG/M |
3300027839|Ga0209403_10064228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2612 | Open in IMG/M |
3300027847|Ga0209402_10549201 | Not Available | 663 | Open in IMG/M |
3300028487|Ga0257109_1235598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. | 507 | Open in IMG/M |
3300028489|Ga0257112_10176710 | Not Available | 752 | Open in IMG/M |
3300031803|Ga0310120_10151701 | Not Available | 1295 | Open in IMG/M |
3300031804|Ga0310124_10777510 | Not Available | 537 | Open in IMG/M |
3300032006|Ga0310344_10217268 | All Organisms → cellular organisms → Bacteria | 1628 | Open in IMG/M |
3300032006|Ga0310344_10789923 | Not Available | 805 | Open in IMG/M |
3300032048|Ga0315329_10411400 | Not Available | 721 | Open in IMG/M |
3300032278|Ga0310345_10942037 | Not Available | 843 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 33.02% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 19.81% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 12.26% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 8.49% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 7.55% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.77% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 3.77% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 2.83% |
Black Smokers Hydrothermal Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume | 2.83% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.89% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.94% |
Deep-Sea Hydrothermal Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Deep-Sea Hydrothermal Vent | 0.94% |
Diffuse Hydrothermal Fluid | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Fluid | 0.94% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.94% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000163 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 2000m | Environmental | Open in IMG/M |
3300000323 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P20 2000m | Environmental | Open in IMG/M |
3300001006 | Marine microbial communities from the Deep Atlantic Ocean - MP0758 | Environmental | Open in IMG/M |
3300001676 | Black smokers hydrothermal plume microbial communities from Tui Malila, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
3300001679 | Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean | Environmental | Open in IMG/M |
3300005402 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 | Environmental | Open in IMG/M |
3300005404 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV205 | Environmental | Open in IMG/M |
3300005427 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 | Environmental | Open in IMG/M |
3300005429 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV76 | Environmental | Open in IMG/M |
3300005595 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF47B | Environmental | Open in IMG/M |
3300005596 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B | Environmental | Open in IMG/M |
3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
3300005753 | Microbial community analysis of hydrothermal vent diffuse flow samples from Mid-Cayman Rise, Pacific Ocean - mega-assembly | Environmental | Open in IMG/M |
3300005945 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_B | Environmental | Open in IMG/M |
3300006012 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_AAIW_ad_750m_LV_A | Environmental | Open in IMG/M |
3300006079 | Microbial communities in diffuse hydrothermal fluids of Manus Basin, Bismarck Sea ? fluid D | Environmental | Open in IMG/M |
3300006166 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 | Environmental | Open in IMG/M |
3300006313 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770m | Environmental | Open in IMG/M |
3300006315 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770m | Environmental | Open in IMG/M |
3300006330 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_1000m | Environmental | Open in IMG/M |
3300006331 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_1000m | Environmental | Open in IMG/M |
3300006341 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770m | Environmental | Open in IMG/M |
3300007283 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_B | Environmental | Open in IMG/M |
3300007509 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300007512 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
3300008629 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 200m, 2.7-0.2um | Environmental | Open in IMG/M |
3300008735 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 2.7-0.2um | Environmental | Open in IMG/M |
3300009103 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 250-2.7um | Environmental | Open in IMG/M |
3300009104 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um | Environmental | Open in IMG/M |
3300009109 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300009110 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 198m, 2.7-0.2um, replicate b | Environmental | Open in IMG/M |
3300009376 | Combined Assembly of Gp0137079, Gp0137080 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
3300009593 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
3300011312 | Marine microbial communities from the Deep Pacific Ocean - MP2100 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300012950 | Marine microbial communities from the Central Pacific Ocean - Fk160115 155m metaG | Environmental | Open in IMG/M |
3300020263 | Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX555942-ERR599125) | Environmental | Open in IMG/M |
3300020268 | Marine microbial communities from Tara Oceans - TARA_B000000477 (ERX556113-ERR599107) | Environmental | Open in IMG/M |
3300020275 | Marine microbial communities from Tara Oceans - TARA_B100002003 (ERX555991-ERR599175) | Environmental | Open in IMG/M |
3300020277 | Marine microbial communities from Tara Oceans - TARA_B100001971 (ERX556102-ERR599152) | Environmental | Open in IMG/M |
3300020322 | Marine microbial communities from Tara Oceans - TARA_B100002003 (ERX556138-ERR599051) | Environmental | Open in IMG/M |
3300020344 | Marine microbial communities from Tara Oceans - TARA_B100001964 (ERX556104-ERR598987) | Environmental | Open in IMG/M |
3300020357 | Marine microbial communities from Tara Oceans - TARA_B100000686 (ERX555950-ERR598956) | Environmental | Open in IMG/M |
3300020373 | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555949-ERR598946) | Environmental | Open in IMG/M |
3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
3300020462 | Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986) | Environmental | Open in IMG/M |
3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
3300021084 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 | Environmental | Open in IMG/M |
3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300025191 | Marine microbial communities from the Deep Atlantic Ocean - MP0104 (SPAdes) | Environmental | Open in IMG/M |
3300025196 | Marine microbial communities from the Deep Atlantic Ocean - MP0440 (SPAdes) | Environmental | Open in IMG/M |
3300025198 | Marine microbial communities from the Deep Indian Ocean - MP0959 (SPAdes) | Environmental | Open in IMG/M |
3300025210 | Marine microbial communities from the Deep Atlantic Ocean - MP1092 (SPAdes) | Environmental | Open in IMG/M |
3300025215 | Marine microbial communities from the Deep Atlantic Ocean - MP0204 (SPAdes) | Environmental | Open in IMG/M |
3300025243 | Marine microbial communities from the Deep Atlantic Ocean - MP0759 (SPAdes) | Environmental | Open in IMG/M |
3300026208 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72 (SPAdes) | Environmental | Open in IMG/M |
3300026254 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 (SPAdes) | Environmental | Open in IMG/M |
3300026263 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes) | Environmental | Open in IMG/M |
3300026265 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV203 (SPAdes) | Environmental | Open in IMG/M |
3300026269 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes) | Environmental | Open in IMG/M |
3300026279 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV261 (SPAdes) | Environmental | Open in IMG/M |
3300026321 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91 (SPAdes) | Environmental | Open in IMG/M |
3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
3300027839 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 (SPAdes) | Environmental | Open in IMG/M |
3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
3300028487 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m | Environmental | Open in IMG/M |
3300028489 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_1000m | Environmental | Open in IMG/M |
3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
3300032048 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 32315 | Environmental | Open in IMG/M |
3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
LPjun09P162000mDRAFT_10228002 | 3300000163 | Marine | RRRSNHPGNSQAKGPYIITLERRLGLTEGVNLSGNKTEGVD* |
LPaug09P202000mDRAFT_10060511 | 3300000323 | Marine | GCRRSNHPGNSQAKGPCIITLERRLGLTEGVNLSGNKTEGVD* |
JGI12027J13101_1009121 | 3300001006 | Deep Ocean | NHPGNSQAKGPYIITLERRRSLTEGAKLSGNKTDGVF* |
TuiMalila_10033941 | 3300001676 | Black Smokers Hydrothermal Plume | DQFNWRRRSNHPGNSQAKGPYIITLERRLGLTEGVNLSGNKTEGVD* |
TuiMalila_10237891 | 3300001676 | Black Smokers Hydrothermal Plume | YGRDQFNWRRRSNHPGNSQAKGPYIITLESRLSLTEGVNLSGN* |
TahiMoana_10274141 | 3300001679 | Black Smokers Hydrothermal Plume | RRSNHPGNSQAKGPYIITLERRRSLTEGAKLSGNKTEGVF* |
Ga0066855_100962592 | 3300005402 | Marine | SYGRDQFSWRRRSNHPGNSQAKGPYIITLERRLGLTEGVNLSGK* |
Ga0066856_104011031 | 3300005404 | Marine | MPSIRERPILLAPKEQRNPGNSQAKGPYIITLESRLCLTEGVNLSG |
Ga0066851_100857471 | 3300005427 | Marine | YGRDQFNWRRRSNHPGNSQAKGPYIMTLERRLSLTEGVNLSGNRTEGVY* |
Ga0066846_102873981 | 3300005429 | Marine | WRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNQTEGV* |
Ga0066846_102957671 | 3300005429 | Marine | YGRDQFNWRRRSNHPGNSQAKEPYIITLERRLGLTEGVNLSGNKTEGVD* |
Ga0066833_102316111 | 3300005595 | Marine | FNWRRRSNHPGNSQAKGPYIMTLERRLSLTEGVNLSGNRTEGVY* |
Ga0066834_100421741 | 3300005596 | Marine | RDQFNWRRRSNHPGNSQAKGPYIMTLERRLSLTEGVNLSGNRTEGVY* |
Ga0066850_102940841 | 3300005605 | Marine | WRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNRTEGVY* |
Ga0066850_103570191 | 3300005605 | Marine | RSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNQTEGV* |
Ga0077776_10479431 | 3300005753 | Deep-Sea Hydrothermal Vent | MQRRRSNHPGNSQAKGPCIITLERRLGLTEGVNLSGNKTEGVD* |
Ga0066381_101868642 | 3300005945 | Marine | SWRRRSNHPGNSQAKGPYIITLERRHSLTEGAKLSGNKTEGVF* |
Ga0066374_102264482 | 3300006012 | Marine | WRRRSNHPGNSQAKGPCIITLERRLGLTEGVNLSGNKTEGVD* |
Ga0081601_10081894 | 3300006079 | Diffuse Hydrothermal Fluid | MQRRRSNHPGNSQAKGPYIITLERRLDLTEGVNLSGNKTEGVD* |
Ga0066836_103216251 | 3300006166 | Marine | MPPYGRDQFYWRRRSNHPGNSQAKGPYIITLESRHCLTEGVN |
Ga0066836_103956691 | 3300006166 | Marine | DQFDWRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGN* |
Ga0066836_105818842 | 3300006166 | Marine | IWRRRSNHPGNSQAKGPYIITLERRQSLTEGVNLSGKKTDGVC* |
Ga0066836_106243102 | 3300006166 | Marine | DQFDWRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNQTEGV* |
Ga0066836_107860522 | 3300006166 | Marine | NWRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGN* |
Ga0068472_102359996 | 3300006313 | Marine | MTNYGRDQFNWRRRSNHPGNSQAKGPCIITLERRLGLTEGVNLSGNKTEGVD* |
Ga0068472_106653341 | 3300006313 | Marine | NHSRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGN* |
Ga0068487_13932601 | 3300006315 | Marine | AKRPQRRRSKHPGNSQAKGPHIITLERRLCLTEGVNLSGTQTEGA* |
Ga0068483_14849171 | 3300006330 | Marine | KDFRASRRSNHPGNSQAKGPYIITLERRHSLTEGAKLSGN* |
Ga0068488_13758301 | 3300006331 | Marine | LHENSQAKGPYIITLESRLALTEGVNLSGNKTEGVD* |
Ga0068488_13999591 | 3300006331 | Marine | RRRSKHPGNSQAKGPYIITLERRLGLTEGVNLSGNKTEGVD* |
Ga0068493_106810732 | 3300006341 | Marine | LQRRRSNHPGNSQAKGPIIITLERRLSLTEGVNLSGK* |
Ga0066366_100864702 | 3300007283 | Marine | RDQYNWRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGTWTEG* |
Ga0105012_11674151 | 3300007509 | Marine | PGNSQAKGPYIITLERRLSLTEGVNLSGTWTEGEDKELL* |
Ga0105016_11474861 | 3300007512 | Marine | LAPKEQHPGNSQAKGPYIITLERRLSLTEGVNLSGTRTEGDDKEL |
Ga0111541_105607091 | 3300008097 | Marine | HPGNSQAKGPYIITLERRLSLTEGVNLSGTRTEGEDKELL* |
Ga0115658_10116548 | 3300008629 | Marine | KTYSTKYILYGRDQFDWRRRSNHPGNSQAKGPYIITLESRHGLTEGVNLSGN* |
Ga0115657_10805911 | 3300008735 | Marine | RRRSNHPGNSQAKGPYIITLERRLCLTEGVNLSGN* |
Ga0115657_11086121 | 3300008735 | Marine | DQFNWRRRSNHPGNSQAKGPYIITLERRLCLTEGVNLSGS* |
Ga0117901_11897581 | 3300009103 | Marine | APKEQRPGNSQAKGPYIITLERRLSLTEGVNLSGN* |
Ga0117902_11910601 | 3300009104 | Marine | RRRSKHPGNSQAKGPHIITLERRLCLTEGVNLSGN* |
Ga0117902_13082001 | 3300009104 | Marine | QFNWRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGTQTEGAG* |
Ga0117922_10410031 | 3300009109 | Marine | YPGNSQAKGPYIITLERRRGLTEGVNLSGTWTEGAC* |
Ga0117925_10666391 | 3300009110 | Marine | RRSNHPGNSQAKGPYIITLERRRGLTEGVNLSGTWTEGAC* |
Ga0118722_12707391 | 3300009376 | Marine | RRRSNHPGNSQAKGPYIITLERRFCLTEGVNLSGN* |
Ga0118722_13648392 | 3300009376 | Marine | QAKGPYIITLERRLSLTEGVNLSGTWTEGEDKELL* |
Ga0118722_13964101 | 3300009376 | Marine | DQFNWRRRSNHPGNSQAKGPYIITLERRLCLTEGVNLSGTQTEGV* |
Ga0114993_100997264 | 3300009409 | Marine | RSNRPGNSQAKGPYIITLESRLSLTEGANLSGKKTDGV* |
Ga0114993_103351921 | 3300009409 | Marine | RRSNHPGNSQAKGPYIITLERRRSLTEGANLSGNKTDGVL* |
Ga0114993_107062211 | 3300009409 | Marine | LIRERPIYWRRRSNHPGNSQAKGPYIITLESRRSLTEGINLSGKKTDGV* |
Ga0114994_109770692 | 3300009420 | Marine | WRRRSNHPGNSQAKGPYIITLERRRSLTEGANLSGKKTDGV* |
Ga0115011_115598021 | 3300009593 | Marine | GRDQFNWRRRSNHPGNSQAKGPYIITLERRRSLTEGVKLSGTQTDGV* |
Ga0114933_107883981 | 3300009703 | Deep Subsurface | LQRRRSNHPGNSQAKGPIIITLERRLSLTEGVNLSGNKTEGA* |
Ga0115002_1000968112 | 3300009706 | Marine | WRRRSNHPGNSQAKGPYIITLERRRSLTEGVNLSGKKTDGV* |
Ga0133547_108091881 | 3300010883 | Marine | RSNHPGNSQAKGPYIITLERRLSLTEGANLSGKKTDGVS* |
Ga0138349_10065431 | 3300011312 | Deep Ocean | QFNWRRRSNHLGNSQAKGPYIITLERRLSLTEGVNLSGK* |
Ga0163108_105350612 | 3300012950 | Seawater | WRRRSNHPGNSQAKGPYIITLESRHGLTEGVNLSGN* |
Ga0163108_107981661 | 3300012950 | Seawater | RRRSNHPGNSQAKGPYIITLESRRCLTEGVNLSGN* |
Ga0163108_109669681 | 3300012950 | Seawater | NWRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNRTEGVY* |
Ga0211679_10370562 | 3300020263 | Marine | MQRRRSNHPGNSQAKGPCIITLERRLGLTEGVNLSGNKTEGVD |
Ga0211495_10271432 | 3300020268 | Marine | YIWRRRSNHPGNSQAKGPYIITLERRLSLTEGANLSGKKTDGV |
Ga0211562_10443091 | 3300020275 | Marine | DSYGRDQFNWRRRSNHLGNSQAKGPYIITLERRLGLTEGVNLSGK |
Ga0211568_10267201 | 3300020277 | Marine | RSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNRTEGVY |
Ga0211563_10494311 | 3300020322 | Marine | WRRRSNHPGNSQAKGPYIITLERRLGLTEGVNLSGK |
Ga0211570_10110081 | 3300020344 | Marine | DQFNWRRRSNHPGNSQAKEPYIITLERRLDLTEGVNLSGNKTEGVD |
Ga0211570_10118171 | 3300020344 | Marine | NHPGNSQAKGPYIITLERRLSLTEGVNLSGNRTEGVY |
Ga0211611_10861732 | 3300020357 | Marine | LAPKEQRPGNSQAKGPYIMTLERRLSLTEGVNLSGN |
Ga0211660_100670291 | 3300020373 | Marine | WRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNRTEGVY |
Ga0211587_100982792 | 3300020411 | Marine | HPGNSQAKGPYIITLERRVDLTEGVNLSGKKTEGV |
Ga0211587_101125071 | 3300020411 | Marine | RSNHPGNSQAKGPYILTLERENILAEGANLSGTQTEGAKG |
Ga0211546_102855741 | 3300020462 | Marine | RRSNHPGNSQAKGPIEAQYSGKRLSSTEGVKLSGKKTEGAL |
Ga0211546_105405171 | 3300020462 | Marine | WRRRSNHPGNSQAKGPYIITLERRLSLTEGANLSGKKTDGV |
Ga0211585_100782404 | 3300020477 | Marine | PGNSQAKGPYIITLERRLSLTEGVNLSGTWTEGAG |
Ga0211585_100833804 | 3300020477 | Marine | RRRSNHPGNSQAKGPCILTLERENILAEGANLSGTQTEGVKG |
Ga0211585_102056981 | 3300020477 | Marine | YGRDQFNWRRRSNHPGNSQAKGPYIITLESRLCLTEGVNLSGT |
Ga0211503_100354991 | 3300020478 | Marine | WRRRSNHPGNSQAKGPYIITLERRLCLTEGVNLSGN |
Ga0211503_100403191 | 3300020478 | Marine | SNHPGNSQAKGPYILTLEREYILAEGANLSGTQTEGAKGLIWK |
Ga0211503_102874401 | 3300020478 | Marine | DWRRRSNHPGNSQAKGPYIITLERRLCLTEGVNLSGN |
Ga0211503_103521562 | 3300020478 | Marine | LAPKEQRPGNSQAKGPYIITLERRLGLTEGVNLSGTWTEGEDKELL |
Ga0211503_105537931 | 3300020478 | Marine | DWRRRSNHPGNSQAKGPYIITLERRVDLTEGVNLSGKKTEGV |
Ga0206678_103066152 | 3300021084 | Seawater | HPGNSQAKGPYILTLEREKFLAEGANLSGYKDRGGK |
Ga0187827_100417754 | 3300022227 | Seawater | MWRRRSNHPGNSQAKGPYILTLERDLFLAEGANLSGKQTEGVKELV |
Ga0207921_1032461 | 3300025191 | Deep Ocean | NWRRRSNHPGNSQAKGPCIITLERRLGLTEGVNLSGNKTEGVD |
Ga0207918_1054971 | 3300025196 | Deep Ocean | WRRRSNHPGNSQAKGPYIITLERRRSLTEGAKLSGNKTDGVF |
Ga0207918_1344181 | 3300025196 | Deep Ocean | ENSQRRRSNHLGNFQAKGPYIITLERRLSLTEGVNLSGNKTEGVY |
Ga0208059_10187131 | 3300025198 | Deep Ocean | NHLGNFQAKGPYIITLERRLSLTEGVNLSGNKTEGVY |
Ga0208058_10160281 | 3300025210 | Deep Ocean | NHLGNFQAKGPYIITLERRRSLTEGVNLSGNKTEGVY |
Ga0207920_10401881 | 3300025215 | Deep Ocean | MQRRRSNHPGNSQAKGPYIITLERRLGLTEGVNLSGNKTEGVD |
Ga0208335_10169772 | 3300025243 | Deep Ocean | SNHLGNFQAKGPYIITLERRLSLTEGVNLSGNKTEGVY |
Ga0208640_10946722 | 3300026208 | Marine | MWRRRSNHPGNSQAKGPYILTLERDLFLAEGANLSGKQTEGVKE |
Ga0208522_10680132 | 3300026254 | Marine | PYGRDQFYWRRRSNHPGNSQAKGPYIITLESRHSLTEGVNLSGN |
Ga0207992_11517661 | 3300026263 | Marine | IIYITKCHTYGRDQFDWRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGNQTEGV |
Ga0208765_11686681 | 3300026265 | Marine | YILYGRDQFDWRRRSNHPGNSQAKGPYIITLERRLSLTEGVNLSGN |
Ga0208766_10173151 | 3300026269 | Marine | NWRRRSNHPGNSQAKGPYIITLERRLCLTEGVNLSGNRTEGAD |
Ga0208411_10077911 | 3300026279 | Marine | IIYRRKCQTYGRDQFDWRRRSNHPGNSQAKGPYIITLESRHSLTEGVNLSGN |
Ga0208764_101672471 | 3300026321 | Marine | WRRRSNHPGNSQAKGPYIITLESRHGLTEGVNLSGN |
Ga0209089_104646081 | 3300027838 | Marine | LIRERPIYWRRRSNHPGNSQAKGPYIITLESRRSLTEGINLSGKKTDGV |
Ga0209403_100642281 | 3300027839 | Marine | WRRRSNHPGNSQAKGPYIITLERRRSLTEGVNLSGKKTDGV |
Ga0209402_105492012 | 3300027847 | Marine | TLIRERPIYWRRRSNHPGNSQAKGPYIITLESRRSLTEGINLSGKKTDGV |
Ga0257109_12355981 | 3300028487 | Marine | HLGNFQAKGPYIITLERRLSLTEGVNLSGNKTEGVY |
Ga0257112_101767102 | 3300028489 | Marine | RRSNHPGNSQAKGPYIITLERRRSLTEGAKLSGNKTEGVF |
Ga0310120_101517012 | 3300031803 | Marine | MQRRRSNHPGNSQAKGPCIITLERRLGLTEGINLSGNKTE |
Ga0310124_107775102 | 3300031804 | Marine | MQRRRSNHPGNSQAKGPCIITLERRLGLTEGINLSGNKTEGVD |
Ga0310344_102172682 | 3300032006 | Seawater | LQRRRSNHPGNSQAKGPIIMTLERRLSLTEGVNLSGNKTEGA |
Ga0310344_107899231 | 3300032006 | Seawater | QRRRSNHPGNSQAKGPHIITLERRLCLTEGVNLSGN |
Ga0315329_104114002 | 3300032048 | Seawater | RRRSNHPGNSQAKGPYIITLESRHCLTEGVNLSGN |
Ga0310345_109420372 | 3300032278 | Seawater | FDWRRRSKHPGNSQAKGPCIITLESRRKSLTEGVNLSGTRTEGAK |
⦗Top⦘ |