NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300025198

3300025198: Marine microbial communities from the Deep Indian Ocean - MP0959 (SPAdes)



Overview

Basic Information
IMG/M Taxon OID3300025198 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0053074 | Gp0054065 | Ga0208059
Sample NameMarine microbial communities from the Deep Indian Ocean - MP0959 (SPAdes)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size80141733
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationEast of Madagascar, South Indian Ocean
CoordinatesLat. (o)-27.98Long. (o)63.25Alt. (m)N/ADepth (m)3504.69
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002753Metagenome / Metatranscriptome532Y
F064726Metagenome / Metatranscriptome128Y
F094378Metagenome / Metatranscriptome106Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0208059_1005259All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1577Open in IMG/M
Ga0208059_1018713Not Available757Open in IMG/M
Ga0208059_1037578Not Available501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0208059_1005259Ga0208059_10052592F064726QKDSTATANNKRKFRSPNRVLARSFRLARDKWKQKYMELRANLKSARQLATERGTSRDLWRAEYDAANQRAIQAEALAQQRLDKLEQLRSEHQELKKKRI
Ga0208059_1018713Ga0208059_10187131F094378NHLGNFQAKGPYIITLERRLSLTEGVNLSGNKTEGVY
Ga0208059_1037578Ga0208059_10375781F002753VNNTVSDRFTPAVFEIESVNNTVSDRFTPAVFETESVKLTDSDRFTPAVFETESVKLTDSDKFTPAVFETESVNDIDSVRFTPDVFEIESVNDTDSDRFTGAVFEIESVKLTVSDRFTPAVFDIESVNNTVSDRFTPAVFEIESVKLTVSDRFTPAVFEIESVKLT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.