NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078213

Metagenome / Metatranscriptome Family F078213

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078213
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 96 residues
Representative Sequence MGTMWNPPAVENMMGRNDEDSLKALGEAYKSAADNIGIQKLAPKKIQDTLRQGGTFVFKGDKLLLEHYDSKVGDNCPVEDILKVL
Number of Associated Samples 88
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 23.28 %
% of genes near scaffold ends (potentially truncated) 62.93 %
% of genes from short scaffolds (< 2000 bps) 97.41 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(52.586 % of family members)
Environment Ontology (ENVO) Unclassified
(73.276 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.483 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.74%    β-sheet: 11.50%    Coil/Unstructured: 55.75%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF13911AhpC-TSA_2 7.76
PF00155Aminotran_1_2 0.86
PF09797NatB_MDM20 0.86



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005826|Ga0074477_1325397All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1407Open in IMG/M
3300005913|Ga0075108_10235292All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta625Open in IMG/M
3300008086|Ga0100388_10462807All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii587Open in IMG/M
3300008094|Ga0100387_10112706All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii1546Open in IMG/M
3300008930|Ga0103733_1075393All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta533Open in IMG/M
3300008931|Ga0103734_1053072All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta618Open in IMG/M
3300008933|Ga0103736_1034172All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta663Open in IMG/M
3300008935|Ga0103738_1055224All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta555Open in IMG/M
3300008938|Ga0103741_1031711All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta968Open in IMG/M
3300008938|Ga0103741_1068283All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta699Open in IMG/M
3300008958|Ga0104259_1012366All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae801Open in IMG/M
3300009195|Ga0103743_1010446All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1177Open in IMG/M
3300009263|Ga0103872_1027115All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita742Open in IMG/M
3300009265|Ga0103873_1106072All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii573Open in IMG/M
3300009432|Ga0115005_10475568All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae995Open in IMG/M
3300009436|Ga0115008_10010400All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta7648Open in IMG/M
3300009543|Ga0115099_10063565All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Biddulphiophycidae → Eupodiscales → Odontellaceae → Odontella → Odontella aurita528Open in IMG/M
3300009543|Ga0115099_10073738All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta793Open in IMG/M
3300009543|Ga0115099_10136138All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Volvocaceae → Volvox → Volvox carteri628Open in IMG/M
3300009543|Ga0115099_10219561All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii917Open in IMG/M
3300009543|Ga0115099_10684709All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta919Open in IMG/M
3300009544|Ga0115006_10607764All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta959Open in IMG/M
3300009592|Ga0115101_1004622All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii611Open in IMG/M
3300009599|Ga0115103_1708577All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta573Open in IMG/M
3300009599|Ga0115103_1845619All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii892Open in IMG/M
3300009606|Ga0115102_10306597All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta500Open in IMG/M
3300009608|Ga0115100_10666210All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1062Open in IMG/M
3300010997|Ga0139324_1067455All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta827Open in IMG/M
3300012412|Ga0138266_1114331All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii552Open in IMG/M
3300012414|Ga0138264_1177738All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae560Open in IMG/M
3300012415|Ga0138263_1426207All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii660Open in IMG/M
3300012782|Ga0138268_1630413All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta559Open in IMG/M
3300016850|Ga0186201_112860All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii563Open in IMG/M
3300016886|Ga0186074_101171All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae3304Open in IMG/M
3300016999|Ga0186304_112510All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii1082Open in IMG/M
3300017008|Ga0186350_109315All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta956Open in IMG/M
3300017010|Ga0186589_111109All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae789Open in IMG/M
3300017024|Ga0186263_112026All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta552Open in IMG/M
3300017030|Ga0186264_110847All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta980Open in IMG/M
3300017073|Ga0186334_115177All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii977Open in IMG/M
3300017133|Ga0186595_113047All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta868Open in IMG/M
3300017232|Ga0186600_129233All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta514Open in IMG/M
3300018608|Ga0193415_1019103All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii579Open in IMG/M
3300018628|Ga0193355_1028887All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta530Open in IMG/M
3300018684|Ga0192983_1054105All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta550Open in IMG/M
3300018684|Ga0192983_1061952All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta507Open in IMG/M
3300018730|Ga0192967_1046088All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta730Open in IMG/M
3300018734|Ga0193290_1042134All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta534Open in IMG/M
3300018740|Ga0193387_1024337All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae873Open in IMG/M
3300018743|Ga0193425_1061861All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta529Open in IMG/M
3300018743|Ga0193425_1062320All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta527Open in IMG/M
3300018743|Ga0193425_1068429All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii502Open in IMG/M
3300018759|Ga0192883_1021072All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta1055Open in IMG/M
3300018762|Ga0192963_1059717All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta619Open in IMG/M
3300018791|Ga0192950_1060555All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta567Open in IMG/M
3300018791|Ga0192950_1067773All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta536Open in IMG/M
3300018848|Ga0192970_1081621All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae590Open in IMG/M
3300018874|Ga0192977_1094781All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae596Open in IMG/M
3300018874|Ga0192977_1102022All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae569Open in IMG/M
3300018874|Ga0192977_1106235All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta554Open in IMG/M
3300018904|Ga0192874_10035144All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta937Open in IMG/M
3300018927|Ga0193083_10040750All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii664Open in IMG/M
3300018930|Ga0192955_10112851All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta685Open in IMG/M
3300018942|Ga0193426_10141303All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii540Open in IMG/M
3300018966|Ga0193293_10035205All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta791Open in IMG/M
3300018966|Ga0193293_10043543All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta743Open in IMG/M
3300018980|Ga0192961_10115507All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta816Open in IMG/M
3300018980|Ga0192961_10141295All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae734Open in IMG/M
3300018980|Ga0192961_10208690All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta584Open in IMG/M
3300018981|Ga0192968_10139639All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii632Open in IMG/M
3300018981|Ga0192968_10152031All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae599Open in IMG/M
3300019009|Ga0192880_10181142All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta521Open in IMG/M
3300019010|Ga0193044_10238352All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta564Open in IMG/M
3300019021|Ga0192982_10349744All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta529Open in IMG/M
3300019022|Ga0192951_10252097All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta660Open in IMG/M
3300019022|Ga0192951_10308317All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta598Open in IMG/M
3300019022|Ga0192951_10325271All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta582Open in IMG/M
3300019022|Ga0192951_10328373All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta579Open in IMG/M
3300019035|Ga0192875_10064557All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae1011Open in IMG/M
3300019035|Ga0192875_10091395All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii834Open in IMG/M
3300019036|Ga0192945_10216022All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta613Open in IMG/M
3300019036|Ga0192945_10269082All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta536Open in IMG/M
3300019037|Ga0192886_10257840All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta572Open in IMG/M
3300019049|Ga0193082_10163029All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii1020Open in IMG/M
3300019049|Ga0193082_10469405All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii695Open in IMG/M
3300019050|Ga0192966_10344999All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta518Open in IMG/M
3300019099|Ga0193102_1017432All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii666Open in IMG/M
3300019116|Ga0193243_1046764All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta600Open in IMG/M
3300019120|Ga0193256_1081624All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii530Open in IMG/M
3300019133|Ga0193089_1148431All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta518Open in IMG/M
3300019150|Ga0194244_10067299All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta624Open in IMG/M
3300019153|Ga0192975_10298508All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta534Open in IMG/M
3300019153|Ga0192975_10315323All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta513Open in IMG/M
3300019749|Ga0193983_1037072All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta681Open in IMG/M
3300021282|Ga0210303_1046650All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii781Open in IMG/M
3300021303|Ga0210308_1093905All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii545Open in IMG/M
3300021379|Ga0213864_10489807All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta616Open in IMG/M
3300021389|Ga0213868_10308749All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Thalassiosirophycidae → Thalassiosirales → Skeletonemataceae → Skeletonema → Skeletonema marinoi-dohrnii complex → Skeletonema marinoi903Open in IMG/M
3300021890|Ga0063090_1076483All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae740Open in IMG/M
3300025288|Ga0210044_10309514All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii840Open in IMG/M
3300027849|Ga0209712_10010540All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta6822Open in IMG/M
3300027849|Ga0209712_10709830All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii554Open in IMG/M
3300027883|Ga0209713_10693719All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii650Open in IMG/M
3300027883|Ga0209713_10708507All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta642Open in IMG/M
3300030709|Ga0307400_10336109All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae959Open in IMG/M
3300030953|Ga0073941_11404513All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta570Open in IMG/M
3300031569|Ga0307489_11146857All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae560Open in IMG/M
3300031729|Ga0307391_10432794All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta732Open in IMG/M
3300031729|Ga0307391_10786696All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii545Open in IMG/M
3300031737|Ga0307387_10333691All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae911Open in IMG/M
3300031750|Ga0307389_10482327All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Bacillariophyceae → Bacillariophycidae → Bacillariales → Bacillariaceae793Open in IMG/M
3300031750|Ga0307389_11116319All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta525Open in IMG/M
3300032073|Ga0315315_11535438All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii576Open in IMG/M
3300032150|Ga0314779_1012466All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta794Open in IMG/M
3300032150|Ga0314779_1036222All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta500Open in IMG/M
3300033572|Ga0307390_10990135All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii533Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine52.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.79%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated8.62%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica6.03%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine3.45%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.72%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer1.72%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.72%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.72%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water1.72%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.86%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.86%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.86%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.86%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.86%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.86%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.86%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005826Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBAEnvironmentalOpen in IMG/M
3300005913Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1EnvironmentalOpen in IMG/M
3300008086Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-12EnvironmentalOpen in IMG/M
3300008094Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-11EnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009263Eukaryotic communities of water from the North Atlantic ocean - ACM27EnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009544Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M MetagenomeEnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010997ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300012412Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016850Metatranscriptome of marine eukaryotic communities from unknown location in ASW medium w/o silicate, at 20 C, 30 psu salinity and 743 ?mol photons light - Tryblionella compressa CCMP 561 (MMETSP0745)Host-AssociatedOpen in IMG/M
3300016886Metatranscriptome of marine eukaryotic communities from unknown location in NEPC medium w/o nitrate, at 20 C, 30 psu salinity and 766 ?mol photons light - Chaetoceros neogracile CCMP 1317 (MMETSP0753)Host-AssociatedOpen in IMG/M
3300016999Metatranscriptome of marine eukaryotic communities from Pacific Ocean in f/2 medium, 13 C, 21 psu salinity and 238 ?mol photons light - Minutocellus polymorphus NH13 (MMETSP1070)Host-AssociatedOpen in IMG/M
3300017008Metatranscriptome of marine eukaryotic communities from North Sea in K medium, 14 C, 21 psu salinity and 372 ?mol photons light - Asterionellopsis glacialis CCMP 1581 (MMETSP1394)Host-AssociatedOpen in IMG/M
3300017010Metatranscriptome of marine eukaryotic communities from Arctic Ocean in K/2 medium with silica, 4 C, 35 psu salinity and 107 ?mol photons light - Chaetoceros cf. neogracile RCC 1993 (MMETSP1336)Host-AssociatedOpen in IMG/M
3300017024Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o silicate, 20 C and 216 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0706)Host-AssociatedOpen in IMG/M
3300017030Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o nitrate, 20 C and 215 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0707)Host-AssociatedOpen in IMG/M
3300017073Metatranscriptome of marine eukaryotic communities from Pacific Ocean in Aquil medium, 13 C, 21 psu salinity and 634 ?mol photons light - Ditylum brightwellii Pop2 (SS10) (MMETSP1063)Host-AssociatedOpen in IMG/M
3300017133Metatranscriptome of marine eukaryotic communities from Arabian Sea in K medium with silica, 15 C, 21 psu salinity and 683 ?mol photons light - Rhizosolenia setigera CCMP 1694 (MMETSP0789)Host-AssociatedOpen in IMG/M
3300017232Metatranscriptome of marine eukaryotic communities from Antarctic Ocean in modified f/2 medium with seawater, 3 C, 33.6 psu salinity and 448 ?mol photons light - Proboscia alata PI-D3 (MMETSP0174)Host-AssociatedOpen in IMG/M
3300018608Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002024 (ERX1782181-ERR1712102)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018734Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001612 (ERX1789403-ERR1719254)EnvironmentalOpen in IMG/M
3300018740Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001996 (ERX1789647-ERR1719307)EnvironmentalOpen in IMG/M
3300018743Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)EnvironmentalOpen in IMG/M
3300018759Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000759 (ERX1789554-ERR1719287)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018791Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782108-ERR1712085)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018904Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789433-ERR1719416)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018942Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002295 (ERX1782357-ERR1712003)EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019035Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789492-ERR1719296)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019099Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000927 (ERX1782419-ERR1712084)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019120Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789686-ERR1719360)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019153Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789708-ERR1719469)EnvironmentalOpen in IMG/M
3300019749Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLT_4-5_MGEnvironmentalOpen in IMG/M
3300021282Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021303Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1080 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300021890Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300025288Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filter (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027883Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean- Svalbard ARC20M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030953Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032150Metatranscriptome of sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB 2018 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0074477_132539713300005826Sediment (Intertidal)GAVGDVLGLAKGFQTMWNPSAVESMMTRNDEKSLKAVGEAYMAAADAIGVQNLAPKDMKDTLRQGGTFVFKGSKAILEHFDEKVGDNCEVDDILAALKQ*
Ga0075108_1023529213300005913Saline LakeVDKMMGRNDEASLKAIGESFKGAVDAIGFKKLAPSKVADTLRQGGTFIYRGSKPLLEHFDSKVGDNAEIDAILSALS*
Ga0100388_1046280713300008086AquiferEGGVVGDVLGLDKGFKTMWNPPAVDNMMKRNDENSLKSLGEAYKAAADNIGIRKLAPKKIEDTLRQGGTFVFKGSNLLLEHYDQKVGDNAEIDDILAALK*
Ga0100387_1011270613300008094AquiferMKRNDENSLKSLGEAYKAAADNIGIRKLAPKKIEDTLRQGGTFVFKGSNLLLEHYDQKVGDNAEIDDILAALK*
Ga0103733_107539313300008930Ice Edge, Mcmurdo Sound, AntarcticaMMKRNDQESLTALGEAYKAAADNIGIQQLAPTNIEDTLRQGGTFIFKGSKPLVAHYDAKVGDNYDIDSILELIKTK*
Ga0103734_105307213300008931Ice Edge, Mcmurdo Sound, AntarcticaLVGVGSQEAASVFASQLEVDPSICFGDDGGIVGDALGLDKGFGTMWNPPAVNAMMSRNDKESLTSLGEKYKGAADKIGIKNLAPKDINDTLRQGGTFIFRGNEALLEHFDAKVGDNCNMDDILALCSK*
Ga0103736_103417213300008933Ice Edge, Mcmurdo Sound, AntarcticaMWNPPAVNAMMSRNDKESLTSLGEKYKGAADKIGIKNLAPKDINDTLRQGGTFIFRGNEALLEHFDAKVGDNCNMDDILALCSK*
Ga0103738_105522413300008935Ice Edge, Mcmurdo Sound, AntarcticaFLFIISPTDGGALGDSLELTKGINTMWNPPAVGEMMKRNDQESLTALGEAYKAAADNIGIQQLAPTNIEDTLRQGGTFIFKGSKPLVAHYDAKVGDNYDIESILELMKTK*
Ga0103741_103171113300008938Ice Edge, Mcmurdo Sound, AntarcticaMNILRKCELKGINTMWNPPAVGEMMKRNDQESLTALGEAYKAAADNIGIQQLAPTNIEDTLRQGGTFIFKGSKPLVAHYDAKVGDNYDIESILELIKTK*
Ga0103741_106828313300008938Ice Edge, Mcmurdo Sound, AntarcticaFLMLFLVGVGSQEAASVFASQLEVDPSICFGDDGGIVGDALGLDKGFGTMWNPPAVNAMMSRNDKESLTSLGEKYKGAADKIGIKNLAPKDINDTLRQGGTFIFRGNEALLEHFDAKVGDNCNMDDILALCSK*
Ga0104259_101236623300008958Ocean WaterMWNPPAVDNMMGRNDQESLKALGEAYKNAADNIGIKNLAPTQIKDTLRQGGTFVFRGEKTVLQHLDTKVGDNCEIDAILASLKTK*
Ga0103743_101044613300009195Ice Edge, Mcmurdo Sound, AntarcticaSVFASQLEVDPSICFGDDGGIVGDALGLDKGFGTMWNPPAVNAMMSRNDKESLTSLGEKYKGAADKIGIKNLAPKDINDTLRQGGTFIFRGNEALLEHFDAKVGDNCNMDDILALCSK*
Ga0103872_102711513300009263Surface Ocean WaterASELGVDPAICFGDDGGAAGDALGLGKGFKTMWNPPAVNAMMERNDQESLTLLGEAYKGAADNIGIKNLAPAKIEDTLRQGGMFAFRGNKVLLEHFDSKVGDNCEIDNILSAITK*
Ga0103873_110607213300009265Surface Ocean WaterNAMMSRNDEESLKALGEAYKSAADNIGFQKLAPADMKDTLRQGGTFVFNGEKLLLEHYDEKVGDNCSIEEILKVLN*
Ga0115005_1047556813300009432MarineMWNPSAIDTMMGRNDEESLKALGESYKSAIDNVGFQKLAPPNMMDTFRQGGTFVFKGNNLLLEHYDEKVGDNCSIDDILKVL*
Ga0115008_1001040033300009436MarineLDIDPSLCFGDEDGRMGDALALEKGFKTMWNPPAVDKMMSRNDEDSLKALGEAYKNAADNIGIQNLAPPNIKDTLRQGGTFVFRGETNVLEHFDGKVGDNCEIDSILQALK*
Ga0115099_1006356513300009543MarineMWNPPAVDAMMARNDKESLTFLGEAYKNAADNIGIQKLAPPAIDDTLRQGGTFVFRGSSLLLEHYDAKVGDNSDVEDILAAIER*
Ga0115099_1007373813300009543MarineLCFGDDGGVMGDTLSLEKGLKTMWNPPAVNDMMERNDQESLTDLGNAYKAAADSIGFQNLAPKNAKDTLRQGGTFVFRGDKLILEHYDTKVGDNCPVDDILAALN*
Ga0115099_1013613813300009543MarineGIDAKLCFGDEGGAAGDVLGLDKGVKTMWNPPAVNAMMSRNDEASLKQLGEAYKTAADNIGFKRLAPTKMEDTLRQGGTFVFKGNKPLLAHYDQKVGDNAEIEDILAALN*
Ga0115099_1021956113300009543MarineVAGDTLRLEKGVKTMWNPPAVENMMGRNDENSLKALGEAYMAAAENIGFQKLAPEDIKDTLRQGGTFVFKGEVPVLEHYDSKVGDNCEIADILKVL*
Ga0115099_1068470923300009543MarineMEFATQLDIDPSLCFGDEGGAVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGFQKLAPKKIADTLRQGGTFVFRGGNTKFQHFDSKVGDNAEIDAILAAI*
Ga0115006_1060776413300009544MarineMMERNDQESLTALGEAYKNAADNIGIQSLAPKEIKDTLRQGGTFVFKGEELLLEHYDDKV
Ga0115101_100462213300009592MarineLCLADDGGVAGDTLRLEKGVKTMWNPPAVENMMGRNDENSLKALGEAYMAAAENIGFQKLAPEDIKDTLRQGGTFVFKGEVPVLEHYDSKVGDNCEIADILKVL*
Ga0115103_170857713300009599MarineMWNPPAVNNMMSRNDEDSLKALGEAYKNAADNIGIKNLAPKKIEDTLRQGGTFIFKGEEPLLQHFDAKVGDNCDIESILQAIGTK*
Ga0115103_184561913300009599MarineMGTMWNPPAVENMMGRNDEDSLKALGEAYKSAADNIGIQKLAPKKIQDTLRQGGTFVFKGDKLLLEHYDSKVGDNCPVEDILKVL*
Ga0115102_1030659713300009606MarineLCFGDEGGAVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGFQKLAPKKIADTLRQGGTFVFRGGNTKFQHFDSKVGDNAEIDAILAAI*
Ga0115100_1066621023300009608MarineMMERNDQESLTALGEAYKNAADNIGIQSLAPKEIKDTLRQGGTFVFKGEELLLEHYDDKVGDNASIENILASISR*
Ga0139324_106745513300010997SedimentMMARNDEESLKDLGEAYKAAADNIGFKNLAPKNIEDTLRQGGTFVFKGSKPLLVHYDQKVGDNAEIEDILSALN*
Ga0138266_111433123300012412Polar MarineAAGDVLSLKKGVNTMWNPPAVSTMMDRNDEDSLKALGEAYKNAADSIGIQNLAPKEIKDTLRQGGTFVFRGDKLLLEYYDEKVGDNANIEDILACV*
Ga0138264_117773823300012414Polar MarineMAGEVLGLGKGFKTMWNPAAIDTMMGRNDEESLKALGESYKAAIDKVGFQKLAPPNMMDTFRQGGTFVFKGNTLLLEHYDEKVGDNCSIDDILKVL*
Ga0138263_142620723300012415Polar MarineGDALELDKGFQTMWNPPAVDNMMGRNDEDSLKMLGESFKGAVDNIGFKQLAPTELKDTLRQGGTFVFKGDKMLLEHFDTKVGDNCEIEDILKVL*
Ga0138268_163041313300012782Polar MarinePAMCFGDEGGAAGDVLNLKNGANTMCNPPAVSTMMDRNDEESLKALGEAYKTAADNIGFQKLAPKRIKDTLRQGGTFVFKGDDLLLEHYDEKVGDNASIDDILACIGK*
Ga0186201_11286013300016850Host-AssociatedGTGEAAAQFASQLDIDPSLCFGDDGGAVGESIGLEKGFKTMWNPPAVDNMMARNDEQSLKALGEAYKGAVDAIGFQNLAPKKIQDTLRQGGTFVFKGDRPLLDHVDAKVGDNCEIEDILFVLN
Ga0186074_10117123300016886Host-AssociatedMKTMWNPKAVEIMMGRNDEMSLKSLGTSYKTAADNIGIQNLAPVKIQDTLRQGGTFVFRGDKLLLEHYDSKVGDNCAIDDILRVL
Ga0186304_11251023300016999Host-AssociatedMWNPPAVSNMMERNNQESLTALGEAYKNAADNIGIQNLAPKEIKDTLRQGGTFVFKGEELLLEHYDDKVGDNASIEDVLACISR
Ga0186350_10931523300017008Host-AssociatedMEFATQLNIDPSQCFGDEGGIVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGIQNLAPKKIGDTLRQGGTFVFRGDKTLFQHFDSKVGDNADIDAILASI
Ga0186589_11110913300017010Host-AssociatedMGDTLKLEKGFKTMWNPPAVENMMGRNDENSLKGLGEAFKGAVDNIGFKQLAPQEIQDTLRQGGTFVFKGDRLLLEHYDAKVGDNCMIEDILKVL
Ga0186263_11202613300017024Host-AssociatedSLCFGDEGGAVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGFQKLAPKKIADTLRQGGTFVFRGGNTKFQHFDSKVGDNAEIDAILAAI
Ga0186264_11084713300017030Host-AssociatedMEFATQLDIDPSLCFGDEGGAVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGFQKLAPKKIADTLRQGGTFVFRGGNTKFQHFDSKVGDNAEIDAILAAI
Ga0186334_11517713300017073Host-AssociatedMKTMWNPPAVDNMMGRNDEASLKALGEAYKSAADNIGLKKLAPEKIKDTLRQGGTFVFKGDTLLLEHYDEKVGDNCLIEDIIKTLN
Ga0186595_11304713300017133Host-AssociatedMWNPPAVNNMMSRNDEDSLKALGEAYKNAADNIGIKNLAPKKIEDTLRQGGTFIFKGEEPLLQHFDAKVGDNCDIESILQAIGTK
Ga0186600_12923313300017232Host-AssociatedKELNIDPSICFADDGGSAGDILGLSKGFGTMWNPPAVDMMMSRNDKESLTMLGNAYKNAADEIGIQKLAPKDVADTLRQGGTFAFRGKTAILEHYDSKVGNNCEINAILSSLSSSS
Ga0193415_101910313300018608MarineDPSLCFGDDGGAVGDILELEKGIKTMWNPPAVNQMMSRNDETSLKQLGEAYKAAADSIGIKNLAPKQIKDTLRQGGTFVFRGNNLLLKHYDTKVGDNCLIDDILKVL
Ga0193355_102888713300018628MarineGIRTMWNPPAVESMMGRNDQESLTELGEAFKRAADNIGIQNLAPKDINDTLRQGGTFVFKGDELLYEHYDAKVGANCDIENVLATIKGR
Ga0192983_105410513300018684MarineGIDPKLCFGDEGGAVGDVLGLGKGFKTMWNPPAVDNMMARNDQDSLKELGEAYKNAADSIGIKNLAPKNIEDTLRQGGTFVFRGNKPLLAHYDQKVGDNAEIQDILAALK
Ga0192983_106195213300018684MarineGTMWNPPAVDAMMARNDESSLKELGSAFKGAVDNISIQKLAPKDISDTLRQGGTFVFRGNKPLLMHFDSKVGDNCSIEDILAAAAIR
Ga0192967_104608813300018730MarineVGDALGLDKGFGTMWNPPAVNAMMSRNDKESLTSLGEKYKGAADKIGIKNLAPKDINDTLRQGGTFIFRGNEALLEHFDAKVGDNCNMDDILALCSK
Ga0193290_104213413300018734MarineDPKLCFGDDCGAVGDVLGLDKGFRTMWNPPALDAMMARNDQDSLKELGVAYKAAADNIGIRNLAPKNIEDTLRQGGTFVFKGSQMLLAHYDQTVGDNAKIEDILSALN
Ga0193387_102433713300018740MarineMWNPSAVENMMKRNDKESLKVIGEAYKSAADNIGFQRLAPANMRDTLRQGGTFVFKGDKLLLEHIDKKVGDNCPIEDIMKVL
Ga0193425_106186113300018743MarineGDEGGAVGDVVGLDKGFKTMWNPPAVDAMMARNDQDSLKEIGEAYKAAADNIGIRNLAPKNIEDTLRQGGTFVFKGSKPLLAHFDKKVGDNAEIEDILAALSLN
Ga0193425_106232013300018743MarineCGAVGDVLGLDKGFRTMWNPPALDAMMVRNDQDSLKDLGEAYKAAADNIGIRNLAPKNIEDTLRQGGTFEFKGSQTLLAHYDQKVGDNAKIEDILSALN
Ga0193425_106842923300018743MarineMGSLKQLGEAYKAAADSIGMKNLAPKQIKDTLRQGGTFVFRGKNLLLKHYDTKVGDNCLIDDILKVL
Ga0192883_102107223300018759MarineMWNPPAVSAMMERNDQESLTALGEAYKNAADNIGIQSLAPKEIKDTLRQGGTFVFKGEELLLEHYDDKVGDNASIENILASISR
Ga0192963_105971713300018762MarineQLAIDPAVCFGDASGAVGDAVQLEKGFSTMWNPPAVTQLLERNDQTSLQELGVAYKSAADAIGITNLAPNDLQDTLRQGGTFVFRGSKLMLEYYDTKVGDNCPIEDILTVL
Ga0192950_106055523300018791MarineAVQNMMARNDQESLTALGEAYKAAADSIGLQNLAPKEIEDTLRQGGTFVFKGNKPLLAHYDTKVGDNCEIEDILAALN
Ga0192950_106777313300018791MarineHGEGGAAGDALALKKGVGTMWNPPAVSMMMERNDEGSLRALGEAYKGAADNIGVQNLAPKLMQDTLRQGGTFVFKGSELRLEHYDEKVGDNASIQDILLAVGK
Ga0192970_108162113300018848MarineLCFADNGGETGEKLGLEKGMKTMWNPSAVDSMMSRNDEDSLKAIGEAYKSAADSIGFQKLAPTNMKDTLKQGGTFVFKGNNLLLEYADQKVGDNCGIDEIMKFL
Ga0192977_109478113300018874MarineLCFADEGGTAGEVLGLGKGFKTMWNPAAIDTMMGRNDEESLKALGESYKAAIDNVGFQKLAPPNMMDTFRQGGTFVFKGNNLLLE
Ga0192977_110202213300018874MarineMWNPSAIDTMMGRNDEESLKALGESYKSAIDNVGFQKLAPPNMMDTFRQGGTFVFKGNNLLLEHYDEKVGDNCSIDDILKVL
Ga0192977_110623513300018874MarineDPSICFGDDGGIVGDALGLDKGFGTMWNPPAVNAMMSRNDKESLTSLGEKYKGAADKIGIKNLAPKDINDTLRQGGTFIFRGNEALLEHFDAKVGDNCNMDDILALCSK
Ga0192874_1003514433300018904MarineMWNPPAVSTMMDRNDEESLKSLGEAYKNAADNIGIQNLAPKQMKDTMRQGGTFVFRGDDLRLEHYDDKVGDNASIRDIMACIP
Ga0193083_1004075023300018927MarineVESSCIKQYDGRNDEESLKALGDAYKTAADNIGIQKLAPDNIKDTLRQGGTFVFNGEKLLLEHYDKKVGDNCSIEDIMKVLN
Ga0192955_1011285113300018930MarineHGDAALEFASQLQIDPSICFGDDGGVVGDALGLGKGFGTMWNPPAVTALMARNDQESLTAVGEAFKGAADNIGIKRLAPAEIGDTLRQGGTFVFRGSQPLLEHFDAKVGDNCEIDAILASIAAK
Ga0193426_1014130313300018942MarineVGDVLGLDKGFRTMWNPPALDAMMARNDQDSLKDLGEAYKAAADNIGIRNLAPKNIEDTLRQGGTFVFKGSQMLLAHYDQKVGDNAKIEDILSALN
Ga0193293_1003520513300018966MarineTWGNPPAVSAMMARNDEESFRALGEAYKGAADNIGIQALAPKRLQDTLRQGGTFVFRGSQLRFEHYDEKAGDNADIQDILLAVGR
Ga0193293_1004354313300018966MarineGESFRDMGEAYKGAADNIGIQALAPKRLQDTLRQGGTFVFRGSQLRFEHYDEKAGDNADIQDILLAVGR
Ga0192961_1011550713300018980MarineMCFADNNGEVGDAIGLEKGFKTMWNPPAVNNMMERNDQESLTFLGEAYKAGADNVGGFQNLAPKKIEDTLRQGGTFVFKGDDLILEHYDSKVGDNCDIDEILKVL
Ga0192961_1014129513300018980MarineMWNPPAVKAMMNRNDEESLKALGEAYKGAADSIGFKNLAPPDMKDTLRQGGIFVFKGSESILEHYDAKVGDNCEIDSILKVLK
Ga0192961_1020869013300018980MarineTMMDRNDEESLKALGEAYKNAADNIGIQNLAPKEMKDTLRQGGTFVFAGDELLLEHYDEKVGDNASIQDILDCIGK
Ga0192968_1013963913300018981MarineASQLDIDPALCFADGAGEMGDTLGLEKGFNTMWNPPAVKSMMGRNDQNSLTAIGEAYKTAADNIGIQNLAPKEIKDTLRQGGTFVFTGDTLLLEHYDSKVGDNCLIEDILDVL
Ga0192968_1015203123300018981MarineVGTAEAAAEFASQLDIDPSICFGDDGGNAGDTLGLGKGFKTMWNPPAVDKMMSRNDEQSLKELGMAYKGAADNIGIKNLAPSDIADTLRQGGTFVFRGEKTLLTH
Ga0192880_1018114223300019009MarineLKAIGEAYKSAADTIGFQKLAPANMKDTLKQGGTFVFKGDSLLLEYIDSKVGDNCPIDEIMSVL
Ga0193044_1023835213300019010MarineKGVNTMWNPPAVSTMMDRNDEDSLKDLGEAYKNAADSIGIQNLAPKEIKDTLRQGGTFVFRGDKLLLEYYDQKVGDNANIEDILACV
Ga0192982_1034974413300019021MarineMGDPSICFGDNGGTAGNALGLEKGFGTMWNPQAVNAMMSRNNQDSLTALGEAYKSAADNIGIKKLAPTDIADTLRQGGTFVFRGNEPILQHFDSKVGDNCDIDAILASICAK
Ga0192951_1025209713300019022MarineVYPPAVTALMARNDQESLTAVGEAFKGAADNIGIKRLAPAEIGDTLRQGGTFVFRGSQPLLEHYDAKVGDNCEIDAILASIAAK
Ga0192951_1030831713300019022MarineTWAAAFAVNLGIDPKLCFGDEGGAVGDVLGLGKGFKTMWNPPAVDNMMARNDQDSLKELGEAYKNAADSIGIKNLAPKNIEDTLRQGGTFVFRGNKPLLAHYDQKVGDNVEIQDILAALK
Ga0192951_1032527113300019022MarineTWAAAFAVNLGIDPKLCFGDEGGAVGDVLGLGKGFKTMWNPPAVDNMMARNDQDSLKELGEAYKNAADSIGIKNLAPKNIEDTLRQGGTFVFRGNKPLLAHYDQKVGDNAEIQDILAALK
Ga0192951_1032837313300019022MarineTWGISPSSCYGDEGGAAGDALALKKGVGTMWNPPAVSMMMERNDEGSLRALGEAYKGAADNIGVQNLAPKLMQDTLRQGGTFVFKGSELRLEHYDEKVGDNASIQDILLAVGK
Ga0192875_1006455713300019035MarineLCFADNGGETGEKLGLEKGMKTMWNPSAVDSMMSRNDEDSLKAIGEAYKSAADSIGFQKLAPTNMKDTLKQGGTFVFKGNNLLLEYADQKVGDNCGIDEIMNFL
Ga0192875_1009139513300019035MarineMLGLEKGLKTMWNPPAVDSMMSRNDEDSLKAIGEAYTSAADSIGIQKLAPTNIKDTLRQGGTFVFKGNNLMLEYFDKKVGDNCPIDEIMRFL
Ga0192945_1021602213300019036MarineVGDAVQLEKGFSTMWNPPAVTQLLERNDQTSLQELGLAYKSAADAIGITNLAPNDPQDTLRQGGTFAFRGKKLMLEYYDTKVGDNCPINDILTVL
Ga0192945_1026908213300019036MarineLALKKGVGTMWNPPAVSMMMERNDEGSLRALGEAYKGAADNIGVQNLAPKLMQDTLRQGGTFVFKGSELRLEHYDEKVGDNASIQDILLAVGK
Ga0192886_1025784013300019037MarineHGWNPPAVDSMMSRNDEDSLKAIGEAYASAADSIGIQKLAPTNIKDTLRQGGTFVFKGNNLMLEYFDKKVGDNCPIDEIMRFL
Ga0193082_1016302923300019049MarineMLGLEKGLKTMWNPPAVDSMMSRNDEDSLKAIGEAYKSAADSIGIQKLAPTNIKDTLRQGGTFVFKGNNLMLEYFDKKVGDNCPIDEIMRFL
Ga0193082_1046940513300019049MarineVGVGSGEAAAEFASQLNIDPALCFGDEDGVVGDNLSLEKGFQTMWNPPAVDNMMSRNDQDSLKVLGEAYKSAADNIGLKNLAPTQIKDTLRQGGTFVFRGEKALLEHFDAKVGDNCEISSILQSLNAK
Ga0192966_1034499913300019050MarineGAVGDVLGLGKGFKTMWNPPAVDNMMARNDQDSLKELGEAYKNAADSIGIKNLAPKNIEDTLRQGGTFVFRGNKPLLAHYDQKVGDNAEIQDILAALK
Ga0193102_101743213300019099MarineFAQNLNIDPKLCFADNGGETGEMLGLEKGLKTMWNPPAVDSMMSRNDEDSLKAIGEAYKSAADSIGIQKLAPTNIKDTLRQGGTFVFKGNNLMLEYFDKKVGDNCPIDEIMRFL
Ga0193243_104676413300019116MarineVDKMMSRNDEESLKALGESFKGAVDSIGIRKLAPEKVADTLRQGGTFVYRGEEALLEHFDAKVGDNCEIDQILSALR
Ga0193256_108162413300019120MarineANLCFADDGGKMGDALQLEKGFKTMWNPPAVDNMMSRNDEESLKAIGESFKGAVDEIGIKNLAPKKIEDTLRQGGTFVFKGDRVLLEHFDSKVGDNCEIDEILSVL
Ga0193089_114843113300019133MarineTWGNPPAVSMMMERNDEGSLRALGEAYKGAADNIGVQNLAPKLMQDTLRQGGTFVFKGSELRLEHYDEKVGDNASIQDILLAVGK
Ga0194244_1006729913300019150MarineEESLKALGESFKGAVDSIGIRKLAPEKVADTLRQGGTFVYRGEEALLEHFDAKVGDNCEIDQILSALR
Ga0192975_1029850813300019153MarineALMARNDQESLTAVGEAFKGAADNIGIKRLAPAEIGDTLRQGGTFVFRGSQPLLEHFDAKVGDNCEIDAILASIAAK
Ga0192975_1031532313300019153MarineALQLEKGFQTMWNPPAVTQMMERNDQTSLQELGLAYKSAADSIGIKNLAPKDIQDTLRQGGTFVFRGNKLLLEYYDTKVGDNCPITDIVNVL
Ga0193983_103707223300019749SedimentMMARNDEESLKELGEAYKAAADNIGFKNLAPKNIEDTLRQGGTFVFKGSNPLLVHYDQKVGDNAEIEDILSALN
Ga0210303_104665023300021282EstuarineGLQQGFKTMWNPPAVSTMMQRNDEESLKALGEAYKNAADNIGIQNLATKDIKDTLRQGGTFVFKGDKLLLEHYDQKVGDNALISDILAFACQ
Ga0210308_109390523300021303EstuarineESLKALGEAYKNAADNIGIQNLATKDIKDTLRQGGTFVFKGDKLLLEHYDQKVGDNALISDILAFACQ
Ga0213864_1048980713300021379SeawaterAMMARNDEESLKELGEAYKAAADNIGFKNLAPKNIEDTLRQGGTFVFKGSNPLLVHYDQKVGDNAEIEDILSALN
Ga0213868_1030874913300021389SeawaterSTMMERNDEDSLKALGEAYKNAADNIGIQNLAPKDIKDTLRQGGTFVFKGDKLLLEHYDQKVGDNAKISDILACVK
Ga0063090_107648323300021890MarineLDIDPSLCFGDEDGRMGDALALEKGFKTMWNPPAVDKMMSRNDEDSLKALGEAYKNAADNIGIQNLAPPNIKDTLRQGGTFVFRGETNVLEHFDGKVGDNCEIDSILQALK
Ga0210044_1030951413300025288GroundwaterNDENSLKSLGEAYKAAADNIGIRKLAPKKIEDTLRQGGTFVFKGSNLLLEHYDQKVGDNAEIDDILAALK
Ga0209712_1001054023300027849MarineMGDTLKLEKGFKTMWNPPAVENMMGRNDENSLKGLGEAFKGAVDNIGFKQLAPQEIQDTLRQGGTFVFKGDQLLLEHYDAKVGDNCMIEDILKVL
Ga0209712_1070983013300027849MarineKGFKTMWNPPAVQSMMGRNDEDSLKALGESFKGAVDKIGFKQLAPEEIQDTLRQGGTFVFKGDRLLLEHYDAKVGDNCMTEDILRVL
Ga0209713_1069371913300027883MarineFGDEGGVAGDNLGLQQGVKTMWNPPAVSTMMERNDEDSLKALGEAYKNAADNIGIQNLAPKDIKDTLRQGGTFVFKGDKLLLEHYDQKVGDNAKISDILACVK
Ga0209713_1070850713300027883MarineAGDALSLKKGVGTMWNPPAVSAMMERNDQESLTALGEAYKNAADNIGIQSLAPKEIKDTLRQGGTFVFKGEELLLEHYDDKVGDNASIENILASISR
Ga0307400_1033610913300030709MarineLCFADNGGETGEKLGLEKGMKTMWNPSAVDSMMSRNDEDSLKAIGEACKSAADSIGFQKLAPTNVKDTLKQGGTFVFKGNNLLLEYADQKVGDNCGIDEIMKFL
Ga0073941_1140451313300030953MarineGIDPAMCFGDDGGTAGDAMGLDKGFKTMWNPAAVDKMMSRNDEESLKALGESFKGAVDSIGIRKLAPEKVADTLRQGGTFVYRGEEALLEHFDAKVGDNCEIDQILSALR
Ga0307489_1114685723300031569Sackhole BrineMGDTLELEKGFKTMWNPPAVQSMMGRNDEDSLKALGESFKGAVDKIGFKQLAPEEIQDTLRQGGTFVFKGDRLLLEHYDAKVGDNCLTEDILKVL
Ga0307391_1043279413300031729MarineLEFASQLEVDPSICFGDNGGTAGNALGLEKGFGTMWNPQAVNAMMSRNNQDSLTALGEAYKSAADNIGIKKLAPTDIADTLRQGGTFVFRGNEPILQHFDSKVGDNCDIDAILASICA
Ga0307391_1078669613300031729MarineAMCFGDEGGAAGDVLNLKKGANTMWNPPAVSTMMDRNDEESLKALGEAYKTAADNIGFQKLAPKRIKDTLRQGGTFVFKGDDLLLEHYDEKVGDNASIDDILACIGK
Ga0307387_1033369113300031737MarineLCFADNGGETGEKLGLEKGMKTMWNPSAVDSMMSRNDEDSLKAIGEAYKSAADSIGFQKLAPTNMKDTLKQGGTFVFKGNNLLLEYVDQKVGDNCGIDEIMNFL
Ga0307389_1048232713300031750MarineLCFADNGGETGEKLGLEKGMKTMWNPSAVDSMMSRNDEDSLKAIGEAYKAAADSIGFQKLAPTNMKDTLKQGGTFVFKGNNLLLEYADQKVGDNCGIDEIMKFL
Ga0307389_1111631913300031750MarineTQLGVSPSICFGDEDGVVGESLELLKGVGTMWNPPAVGKMMERNNQESLTLLGQSYKKAADNIGIQKLAPTNIEDTLRQGGTFIFKGNTPLVAHYDEKVGDNYDIESTLGLIATK
Ga0315315_1153543813300032073SeawaterAGDVLGLDKGVKTMWNPPAVNAMMSRNDEASLKQLGEAYKTAADNIGFKRLAPTKMEDTLRQGGTFVFKGNKPLLAHYDQKVGDNAEIEDILAALN
Ga0314779_101246613300032150SedimentMQLGQGFKTMWNPKAVNNLMARNDQDSLTELGNSYKNAADNLGIKGIMPKKTEDTLRQGGTFVFRGSQLVLEHFDTKVGDNCEVDAILAAMRS
Ga0314779_103622213300032150SedimentADEGGVAGDAMQLGQGFKTMWNPKAVNNLMARNDQDSLTALGNSYKIAADNLGLKGIMPKKTEDTLRQGGTFVFRGSRSVLEHFDTKVGDNCEVDAILAAIRS
Ga0307390_1099013513300033572MarineEAAAEFAANLNVDPAMCFGDEGGAVGDVLNLKKGANTMWNPPAVSTMMDRNDEESLKALGEAYKTAADNIGFQKLAPKQIKDTLRQGGTFVFKGDNLLLEHYDEKVGDNASIEDILACIR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.