3300017030: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o nitrate, 20 C and 215 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0707)

Overview

Basic Information

• IMG/M Taxon OID: 3300017030
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0211976 | Ga0186264
• Sample Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in NEPC medium, resuspended w/o nitrate, 20 C and 215 ?mol photons light - Asterionellopsis glacialis CCMP 134 (MMETSP0707)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 26692564
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	1
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Pacific Ocean
• Coordinates
  • Lat. (^o): 32.655
  • Long. (^o): -117.14
  • Alt. (m): N/A
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015298	Metagenome / Metatranscriptome	255	Y
F078213	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186264_110847	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta	980
Ga0186264_113557	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Coscinodiscophyceae → Rhizosoleniophycidae → Rhizosoleniales → Rhizosoleniaceae → Proboscia → Proboscia inermis	705

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186264_110847	Ga0186264_1108471	F078213	MEFATQLDIDPSLCFGDEGGAVGDSIGLEKGFSTMWNPPAVDAMMSRNDQESLTELGNAYKNAADNIGFQKLAPKKIADTLRQGGTFVFRGGNTKFQHFDSKVGDNAEIDAILAAI
Ga0186264_113557	Ga0186264_1135571	F015298	MNAILEYLIAHKDWLLLVCFSVDAVNTLISFPLIMWKGPKWLLQSTDPDAKEKVEDAKVVVDLTDTDRKSFEVLWEIFGICYEGYFGFTISTLICLFKVPETRPIFAYSLFALYLYKAKAFLRTTIKTDNPQGKGKYMSILFFYWPCYGGYCLLHSIETYFL