3300017073: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in Aquil medium, 13 C, 21 psu salinity and 634 ?mol photons light - Ditylum brightwellii Pop2 (SS10) (MMETSP1063)

Overview

Basic Information

• IMG/M Taxon OID: 3300017073
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0128947 | Gp0212046 | Ga0186334
• Sample Name: Metatranscriptome of marine eukaryotic communities from Pacific Ocean in Aquil medium, 13 C, 21 psu salinity and 634 ?mol photons light - Ditylum brightwellii Pop2 (SS10) (MMETSP1063)
• Sequencing Status: Permanent Draft
• Sequencing Center: National Center for Genome Resources
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 38203082
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii	1
All Organisms → cellular organisms → Eukaryota → Sar	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
• Type: Host-Associated
• Taxonomy: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: Pacific Ocean
• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067805	Metagenome / Metatranscriptome	125	Y
F078213	Metagenome / Metatranscriptome	116	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
Ga0186334_115177	All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii	977
Ga0186334_119826	All Organisms → cellular organisms → Eukaryota → Sar	594

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0186334_115177	Ga0186334_1151771	F078213	MKTMWNPPAVDNMMGRNDEASLKALGEAYKSAADNIGLKKLAPEKIKDTLRQGGTFVFKGDTLLLEHYDEKVGDNCLIEDIIKTLN
Ga0186334_119826	Ga0186334_1198261	F067805	MAKKSKSQEVEITLSKKDQKKVTKLEAQLPYHEGRGNKDEVSKIKQQIESIWEKTREAAY