NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F076109

Metagenome Family F076109

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076109
Family Type Metagenome
Number of Sequences 118
Average Sequence Length 42 residues
Representative Sequence MEVLFKILFVIAVIATILCLCVFLGSLFILFQKNELPDIEDV
Number of Associated Samples 63
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.05 %
% of genes near scaffold ends (potentially truncated) 26.27 %
% of genes from short scaffolds (< 2000 bps) 81.36 %
Associated GOLD sequencing projects 52
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.966 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment
(27.966 % of family members)
Environment Ontology (ENVO) Unclassified
(35.593 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Sediment (saline)
(42.373 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.14%    β-sheet: 0.00%    Coil/Unstructured: 52.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF01381HTH_3 7.63
PF07238PilZ 7.63
PF14659Phage_int_SAM_3 2.54
PF00589Phage_integrase 2.54
PF03069FmdA_AmdA 1.69
PF03372Exo_endo_phos 1.69
PF00216Bac_DNA_binding 0.85
PF04545Sigma70_r4 0.85
PF01663Phosphodiest 0.85
PF02899Phage_int_SAM_1 0.85
PF02230Abhydrolase_2 0.85
PF13424TPR_12 0.85
PF03740PdxJ 0.85
PF12675DUF3795 0.85
PF12773DZR 0.85
PF01885PTS_2-RNA 0.85
PF02730AFOR_N 0.85
PF04989CmcI 0.85
PF03692CxxCxxCC 0.85
PF13183Fer4_8 0.85
PF00078RVT_1 0.85
PF13091PLDc_2 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 1.69
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.85
COG0854Pyridoxine 5'-phosphate synthase PdxJCoenzyme transport and metabolism [H] 0.85
COG1859RNA:NAD 2'-phosphotransferase, TPT1/KptA familyTranslation, ribosomal structure and biogenesis [J] 0.85
COG2414Aldehyde:ferredoxin oxidoreductaseEnergy production and conversion [C] 0.85
COG3510Cephalosporin hydroxylaseDefense mechanisms [V] 0.85
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.85
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.85


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.81 %
UnclassifiedrootN/A21.19 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000118|TDF_OR_ARG05_123mDRAFT_c1013428Not Available676Open in IMG/M
3300000122|TDF_OR_ARG04_123mDRAFT_c1006322All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1135Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1001005All Organisms → cellular organisms → Bacteria → Proteobacteria8461Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1006832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3101Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1039513All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1085069Not Available607Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1113661Not Available514Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1119415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium500Open in IMG/M
3300000792|BS_KBA_SWE02_21mDRAFT_10119131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium662Open in IMG/M
3300001685|JGI24024J18818_10036851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1879Open in IMG/M
3300004008|Ga0055446_10165655All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium643Open in IMG/M
3300004008|Ga0055446_10210748All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium581Open in IMG/M
3300004023|Ga0055441_10029102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1149Open in IMG/M
3300004028|Ga0055447_10207956Not Available633Open in IMG/M
3300004028|Ga0055447_10294683All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium549Open in IMG/M
3300004029|Ga0055442_10109445Not Available835Open in IMG/M
3300004073|Ga0055516_10049095All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium858Open in IMG/M
3300004073|Ga0055516_10153688Not Available563Open in IMG/M
3300004147|Ga0055515_10059078All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium893Open in IMG/M
3300005214|Ga0069002_10142095Not Available633Open in IMG/M
3300005588|Ga0070728_10021775All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales4731Open in IMG/M
3300005588|Ga0070728_10131065All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1462Open in IMG/M
3300005588|Ga0070728_10425332All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium702Open in IMG/M
3300005589|Ga0070729_10354019All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium819Open in IMG/M
3300005589|Ga0070729_10635353All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium576Open in IMG/M
3300005590|Ga0070727_10727529Not Available557Open in IMG/M
3300005590|Ga0070727_10782437All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium535Open in IMG/M
3300005601|Ga0070722_10003121All Organisms → cellular organisms → Bacteria4441Open in IMG/M
3300005609|Ga0070724_10099156All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1258Open in IMG/M
3300005612|Ga0070723_10352410All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium704Open in IMG/M
3300005612|Ga0070723_10399191All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium665Open in IMG/M
3300005832|Ga0074469_10038085All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria10276Open in IMG/M
3300005832|Ga0074469_11269675All Organisms → cellular organisms → Bacteria5668Open in IMG/M
3300005920|Ga0070725_10183333All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfosudaceae → Desulfosudis → Desulfosudis oleivorans908Open in IMG/M
3300005920|Ga0070725_10283193All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium727Open in IMG/M
3300006467|Ga0099972_10566713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3058Open in IMG/M
3300006467|Ga0099972_12596888All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1721Open in IMG/M
3300006467|Ga0099972_12705314All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium601Open in IMG/M
3300006467|Ga0099972_12947060All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium1785Open in IMG/M
3300006467|Ga0099972_12959522Not Available506Open in IMG/M
3300006467|Ga0099972_13388304All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium3627Open in IMG/M
3300008517|Ga0111034_1105041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1806Open in IMG/M
3300009509|Ga0123573_10167234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium2192Open in IMG/M
3300010392|Ga0118731_100611235All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1459Open in IMG/M
3300010392|Ga0118731_107829769All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium657Open in IMG/M
3300010392|Ga0118731_108351612Not Available567Open in IMG/M
3300010392|Ga0118731_110246231Not Available951Open in IMG/M
3300010392|Ga0118731_110586740Not Available589Open in IMG/M
3300010392|Ga0118731_113746674All Organisms → cellular organisms → Bacteria → Proteobacteria3222Open in IMG/M
3300010392|Ga0118731_114145916Not Available1190Open in IMG/M
3300010392|Ga0118731_115634040All Organisms → cellular organisms → Bacteria1612Open in IMG/M
3300010412|Ga0136852_10274873All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1665Open in IMG/M
3300010430|Ga0118733_100146072All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae4721Open in IMG/M
3300010430|Ga0118733_100357672All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium2892Open in IMG/M
3300010430|Ga0118733_105274239All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300010430|Ga0118733_105481082Not Available668Open in IMG/M
3300010430|Ga0118733_105952155Not Available639Open in IMG/M
3300010430|Ga0118733_106532526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium608Open in IMG/M
3300011118|Ga0114922_10505700All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium999Open in IMG/M
3300011118|Ga0114922_11455280Not Available551Open in IMG/M
3300011256|Ga0151664_1013740All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium590Open in IMG/M
3300011257|Ga0151658_1116090All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1246Open in IMG/M
3300011257|Ga0151658_1211029All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300022201|Ga0224503_10065012All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1117Open in IMG/M
3300022201|Ga0224503_10136254Not Available782Open in IMG/M
3300022201|Ga0224503_10173573All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium695Open in IMG/M
3300022218|Ga0224502_10078413All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1247Open in IMG/M
3300022307|Ga0224507_10150077All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanococci → Methanococcales → Methanococcaceae → Methanococcus → Methanococcus maripaludis928Open in IMG/M
(restricted) 3300022913|Ga0233404_10076497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium780Open in IMG/M
(restricted) 3300022938|Ga0233409_10053449All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1187Open in IMG/M
(restricted) 3300022938|Ga0233409_10154896All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium756Open in IMG/M
(restricted) 3300023085|Ga0233406_10011392All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium981Open in IMG/M
(restricted) 3300023086|Ga0233407_10044434All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium656Open in IMG/M
(restricted) 3300023089|Ga0233408_10126168All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium565Open in IMG/M
(restricted) 3300024519|Ga0255046_10150589All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1030Open in IMG/M
(restricted) 3300024519|Ga0255046_10197185Not Available913Open in IMG/M
(restricted) 3300024529|Ga0255044_10413850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium564Open in IMG/M
3300025557|Ga0210141_1000159All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae9816Open in IMG/M
3300025557|Ga0210141_1000552All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria6673Open in IMG/M
3300025557|Ga0210141_1011398All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1736Open in IMG/M
3300025557|Ga0210141_1043123Not Available861Open in IMG/M
3300025564|Ga0210084_1010095Not Available1711Open in IMG/M
3300025564|Ga0210084_1019830All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300025564|Ga0210084_1024930Not Available1118Open in IMG/M
3300025564|Ga0210084_1036225All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium938Open in IMG/M
3300025977|Ga0210072_1043667All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium597Open in IMG/M
3300025983|Ga0210106_1086016Not Available519Open in IMG/M
3300026352|Ga0210107_1030915Not Available815Open in IMG/M
3300027742|Ga0209121_10099233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1244Open in IMG/M
3300027758|Ga0209379_10021195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2722Open in IMG/M
3300027758|Ga0209379_10033689All Organisms → cellular organisms → Bacteria → Proteobacteria2036Open in IMG/M
3300027758|Ga0209379_10050946All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300027758|Ga0209379_10090205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1114Open in IMG/M
3300027758|Ga0209379_10144634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium838Open in IMG/M
3300027790|Ga0209273_10249657All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium732Open in IMG/M
3300027820|Ga0209578_10298559Not Available749Open in IMG/M
3300027828|Ga0209692_10440253All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium551Open in IMG/M
3300027834|Ga0209344_10282758All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium806Open in IMG/M
3300027845|Ga0209271_10002371All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales6860Open in IMG/M
3300027845|Ga0209271_10041182All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1920Open in IMG/M
3300027845|Ga0209271_10057754All Organisms → cellular organisms → Bacteria1614Open in IMG/M
3300027852|Ga0209345_10200497All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1258Open in IMG/M
3300027858|Ga0209013_10008665All Organisms → cellular organisms → Bacteria8452Open in IMG/M
3300027858|Ga0209013_10033313All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3783Open in IMG/M
3300027858|Ga0209013_10097617All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1930Open in IMG/M
(restricted) 3300027861|Ga0233415_10026618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium2326Open in IMG/M
(restricted) 3300027861|Ga0233415_10090481All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1334Open in IMG/M
3300027967|Ga0209272_10099949All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300027967|Ga0209272_10272369All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium581Open in IMG/M
(restricted) 3300028045|Ga0233414_10129382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1106Open in IMG/M
3300031578|Ga0307376_10395841All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium909Open in IMG/M
3300032231|Ga0316187_10191131All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1584Open in IMG/M
3300032258|Ga0316191_10025474All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae4462Open in IMG/M
3300032260|Ga0316192_10109829All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1932Open in IMG/M
3300032263|Ga0316195_10053405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2085Open in IMG/M
3300032263|Ga0316195_10428182Not Available701Open in IMG/M
3300032272|Ga0316189_11193145All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium575Open in IMG/M
3300033429|Ga0316193_10326849All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1217Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment27.97%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands17.80%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine11.86%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater7.63%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine5.93%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine5.08%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment4.24%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow3.39%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment2.54%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine2.54%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.54%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.69%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.69%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.69%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment1.69%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.85%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.85%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000118Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3mEnvironmentalOpen in IMG/M
3300000122Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 04_12.3mEnvironmentalOpen in IMG/M
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300000792Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21mEnvironmentalOpen in IMG/M
3300001685Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2EnvironmentalOpen in IMG/M
3300004008Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2EnvironmentalOpen in IMG/M
3300004023Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2EnvironmentalOpen in IMG/M
3300004028Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2EnvironmentalOpen in IMG/M
3300004029Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2EnvironmentalOpen in IMG/M
3300004073Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2EnvironmentalOpen in IMG/M
3300004147Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2EnvironmentalOpen in IMG/M
3300005214Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2EnvironmentalOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300005609Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005832Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBBEnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300008517Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010412Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011256Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, totalEnvironmentalOpen in IMG/M
3300011257Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_3, 0.2EnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022218Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022307Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023085 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MGEnvironmentalOpen in IMG/M
3300023086 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024529 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21EnvironmentalOpen in IMG/M
3300025557Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025564Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025977Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025983Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026352Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300027742Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027828Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027834Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027852Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes)EnvironmentalOpen in IMG/M
3300027858Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027967Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
TDF_OR_ARG05_123mDRAFT_101342833300000118MarineMEVLFKILFFIAFIAFILCLCVFVGGLFMAFKEVELPDLEDV*
TDF_OR_ARG04_123mDRAFT_100632233300000122MarineMEVLFKILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV*
TDF_OR_ARG05_123mDRAFT_1001005123300000242MarineMGVLFNILFVIAVIATICCLCVFIGGLFIWFQKNELPDIEDF*
TDF_OR_ARG05_123mDRAFT_100683243300000242MarineMEVLFKILFVIAFIAFILCLCVFAAGLFMAFQKNELPDLEDVKTGSNA*
TDF_OR_ARG05_123mDRAFT_103951323300000242MarineMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDFDDV*
TDF_OR_ARG05_123mDRAFT_108506923300000242MarineMELLFKILFVIAVIATICCLCVFIGGLFIWFQKNELPDIEDF*
TDF_OR_ARG05_123mDRAFT_111366113300000242MarineMEVLFKILFVIASIAFIFCLCVFITGLFNQKNSSQ
TDF_OR_ARG05_123mDRAFT_111941523300000242MarineMEVFFKILFVIASIAFIFCLCVFITGLFNGFQKNELPDFDDV*
BS_KBA_SWE02_21mDRAFT_1011913123300000792MarineMEVLFKILFVIALIATIFCLCVFFGGLFIALQKNELPDIEDV*
JGI24024J18818_1003685143300001685MarineMEVLFKILFVIAFIAFIFCLWVFIAGVFDAVQKNELPDIEDV*
Ga0055446_1016565513300004008Natural And Restored WetlandsMEVLFKILFVIAFIGFILCLCVFAVGLFMAFQKNELPDLEDV*
Ga0055446_1021074823300004008Natural And Restored WetlandsMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV*
Ga0055441_1002910213300004023Natural And Restored WetlandsAIIFRGLLIMEVFFNILFVISVMASIFCLCIFLGNLYILFQKNEFPDIEDV*
Ga0055447_1020795623300004028Natural And Restored WetlandsMIMEELFNLFFVISVIATIFCPCVFMGGLLIAFQKSELPDIEDV*
Ga0055447_1029468323300004028Natural And Restored WetlandsMEVFFNILFVISVMASIFCLCIFLGNLYILFQKNEFPDIEDV*
Ga0055442_1010944523300004029Natural And Restored WetlandsMGVLFNILFVIAVIATIICLCVFLGSLFNLFKKNEILDIEDV*
Ga0055516_1004909523300004073Natural And Restored WetlandsMGVLFNILFVIAVIATICCLCVFIGGLFIWFQKNELPDIEEF*
Ga0055516_1015368813300004073Natural And Restored WetlandsMGVLFNILFVIAVIATIICLCVFLGSLFNLFKKNEMLDIEDV*
Ga0055515_1005907813300004147Natural And Restored WetlandsMEVLFKILIVIAFIGFILCLCVFAVGLFMAFQKNELPDLEDV*
Ga0069002_1014209523300005214Natural And Restored WetlandsMEVLFKILFVIAFIAFILCLFVFVGGLFMAFKEVELPDIEDV*
Ga0070728_10021775103300005588Marine SedimentMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV*
Ga0070728_1013106523300005588Marine SedimentMGVLFNILFVIAFIAFILCLCVFAVGLFMAFQKNELPDLEDV*
Ga0070728_1042533233300005588Marine SedimentMEVLFNILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV*
Ga0070729_1035401923300005589Marine SedimentMELLFKILFVMAFIAFIFCLCVFAGGIFMTFQKNELPDLEDV*
Ga0070729_1063535323300005589Marine SedimentMEVFFNILFVIAVIATIFCLCVFMGGLFIVFEKNEFPDIEDV*
Ga0070727_1072752923300005590Marine SedimentMEVLFKILFVIASIGFIFCLCVFIAGVFDAFQKNELPEMEDV*
Ga0070727_1078243713300005590Marine SedimentFLIAFIAFILCLCVFVSGLFMAFKEVELPDLEDV*
Ga0070722_1000312163300005601Marine SedimentMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDI*
Ga0070724_1009915613300005609Marine SedimentMEILFKILFVIAVIATICCLCVFIGGLFIWFQKNELPDIED
Ga0070723_1035241023300005612Marine SedimentMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPD
Ga0070723_1039919133300005612Marine SedimentIMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV*
Ga0074469_10038085113300005832Sediment (Intertidal)MEVLFNILFVIAVMASIFCLCIFLGNLFILFQKNELPDIEDV*
Ga0074469_1126967553300005832Sediment (Intertidal)MEVLFNILFVIALIATIFCLCVFFGGLFTGFQKNELPDIEDV*
Ga0070725_1018333313300005920Marine SedimentILFVIALIATIFCLCVFIGGLFIAFQKYELPDIENV*
Ga0070725_1028319333300005920Marine SedimentLIMEVLFKILFVIAFIAFIFCLCVFAGGIFMTFQKNELPDLKDV*
Ga0099972_1056671343300006467MarineMGVLFNIFFVIAVIATIVCLCVFLGSLFILFQKNELPDIEDF*
Ga0099972_1259688823300006467MarineMELLFKILFVIAFIAFIFCLCVFAGGIFMTFQKNELPDLEDV*
Ga0099972_1270531413300006467MarineLLIMEVLFKMLFVIALIATIFCLCVFMGGLFNAFQKEELPDIEDV*
Ga0099972_1294706013300006467MarineMEVLFKILFVIAFIAFILCLCVFAAGLFMAFQKNELPDLEDFKTGSNA*
Ga0099972_1295952213300006467MarineMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEF
Ga0099972_1338830413300006467MarineMEVLFKILFVIASIAFIFCLCVFIAGFFDAFQKNKLPNI
Ga0111034_110504123300008517Marine SedimentMIMEVLFNILFVVSVIAAILCLCVFLGSLFILFQKNELPDIEDV*
Ga0123573_1016723433300009509Mangrove SedimentMEVFFNILFVVAVIASILCLCIFLGNLLILFEKDEFPDIEDV*
Ga0118731_10061123523300010392MarineMEVLFKMLFVIALIATIFCLCVFMGGLFNAFQKEELPDIEDV*
Ga0118731_10782976923300010392MarineMEVLFKILFLIAFIAFILCLCVFVGGLFMAFKEVELPDLEDV*
Ga0118731_10835161213300010392MarineVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV*
Ga0118731_11024623123300010392MarineMEVLFKILFVIAFMAFILCLCVFVGGLFMAFKEVELPDIEEVEVSKGILSSNLPS*
Ga0118731_11058674013300010392MarineMEVLFKILFVISVIAAILCLCVFLGSLFILFQKNELPDIE
Ga0118731_11374667423300010392MarineMELLFKILFVMAFIAFIFCLCVFAGGIFMTFQKNELPDLKDV*
Ga0118731_11414591613300010392MarineMEVFFKILFVIASIAFIFCLCVFIAGVFDAVQKNELPDFEDV*
Ga0118731_11563404023300010392MarineMEVLFKILFVIASIAFIFCLCVFIAGFFDAFQKNKLPNIENV*
Ga0136852_1027487313300010412Mangrove SedimentMEVFFNILFVIAVIASIFCLCIFLGNLLILFEKDEFPDIEDV*
Ga0118733_10014607263300010430Marine SedimentMEVLFKILFFIALIATIFCLCVFIGGLFIAFQKYELPDIENV*
Ga0118733_10035767253300010430Marine SedimentMELLFKILFVIAFIAFIFCLCVFAGGIFMTFQKNELPDLKDV*
Ga0118733_10527423913300010430Marine SedimentMEVLFKILFVIAFIAFILCLCVFAAGLFMAFQKNELPDLEDVKTG
Ga0118733_10548108223300010430Marine SedimentMEVLFKIFFVIASIGFIFCLCVFIAGVFDAFQKNELPEMEDV
Ga0118733_10595215513300010430Marine SedimentMEVLFKILFVIAFIAFILCLFVFVGGLFMAFKEVELPDMEDV*
Ga0118733_10653252613300010430Marine SedimentMDVLFNILFVIAVIATIFCLCVFMGGLFIVFEKNEFPDFEDVEVSNSG*
Ga0114922_1050570023300011118Deep SubsurfaceMEVLFNILFVVSVIAAILCLCVFLGSLFILFQKNELPDIEDV*
Ga0114922_1145528023300011118Deep SubsurfaceMEVLFNILFVVSVIVAILCLCVFLDSLFILFQKNELPNIEDV*
Ga0151664_101374023300011256MarineMEVLFNILIVIAVIATIICLRVFLGSLLILFQQNELRDIVDV*
Ga0151658_111609033300011257MarineMEVLFKILFVIAFIAFIFCLWVFMGGLFVAFQKNELPDIEDV*
Ga0151658_121102913300011257MarineMGVLFNILFVIAVIATIFCLCVFLGGLFILFEKDELPDIEDF*
Ga0224503_1006501243300022201SedimentKILFVIAFIAFILCLFVFVGGLFMAFKEVELPDIEDV
Ga0224503_1013625413300022201SedimentMGVLFNILFVIAVIATIICLCVFLGSLFNLFKKNEMLDIEDG
Ga0224503_1017357323300022201SedimentMEVFFNILFVISVMASIFCLCIFLGNLYILFQKNEFPDIEDV
Ga0224502_1007841343300022218SedimentKILFVFAFIAFILCLFVFVGGLFMAFKEVELPDIEDV
Ga0224507_1015007733300022307SedimentMEVLFKILFVIAFIAFILCLFVFVGGLFMAFKEVELPDIED
(restricted) Ga0233404_1007649723300022913SeawaterMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV
(restricted) Ga0233409_1005344913300022938SeawaterMEVLFKILFVIALIATIFCLCVFMAGAFIAFQKNELPDIDDL
(restricted) Ga0233409_1015489623300022938SeawaterMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV
(restricted) Ga0233406_1001139243300023085SeawaterIMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV
(restricted) Ga0233407_1004443423300023086SeawaterMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDLEDV
(restricted) Ga0233408_1012616813300023089SeawaterMEVVFNILFVVSVISAILCLCMFLDSLFIAFQKNELPDIEDV
(restricted) Ga0255046_1015058923300024519SeawaterMGVLFNILFVVAVIAIIICLCVFLGGLFILFEKNELPDMEDV
(restricted) Ga0255046_1019718523300024519SeawaterMEVFFNILFVIAVIATIFCLCVFMGGLFIVLEKNEFPDIEDV
(restricted) Ga0255044_1041385023300024529SeawaterTIIFRGLLIMEVLFKILFVIALIATIFCLCVFIGGLFIAFQKYELPDIENV
Ga0210141_100015933300025557Natural And Restored WetlandsMEVLFKILFVIAFIAFILCLFVFVGGLFMAFQKNELPDLEDV
Ga0210141_100055283300025557Natural And Restored WetlandsMEVLFKILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV
Ga0210141_101139823300025557Natural And Restored WetlandsMEVLFKILFVIAFIGFILCLCVFAVGLFMAFQKNELPDLEDV
Ga0210141_104312323300025557Natural And Restored WetlandsMEELFNLFFVISVIATIFCPCVFMGGLLIAFQKSELPDIEDV
Ga0210084_101009533300025564Natural And Restored WetlandsMEVLFKILFVVAFIGFILCLCVFAVGLFMAFQKNELPDLEDV
Ga0210084_101983023300025564Natural And Restored WetlandsMEVIFNIMFFVSVIAAIFCLCVFLGSLFILFQKNELPDIEDV
Ga0210084_102493013300025564Natural And Restored WetlandsMGVLFSILFVIAVIATIICLCVFLGSLFNLFKKNEMLDIEDG
Ga0210084_103622513300025564Natural And Restored WetlandsMEVLFKILFFVSVVAAILCLCVFLGSLFILFQKNELPDIEDV
Ga0210072_104366723300025977Natural And Restored WetlandsMEVLFKIFFVIAFIAFILCMFVFVGGLFMAFKEVELPDIEDV
Ga0210106_108601613300025983Natural And Restored WetlandsMEVLFKMLFVIALIATIFCLCVFIGGLFNAFQKEE
Ga0210107_103091523300026352Natural And Restored WetlandsMGVLFNILFVIAVIATIICLCVFLGSLFNLFKKNEMLDIEDV
Ga0209121_1009923313300027742MarineMEALFNILFVIAFIAFILCLCVFIAGIFDAFQKNELPEIEYVVVGKGEI
Ga0209379_1002119513300027758Marine SedimentFRGLLIMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV
Ga0209379_1003368933300027758Marine SedimentMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDME
Ga0209379_1005094613300027758Marine SedimentMEVLFKILFVIALIATIFCLCVFIGGLFIAFQKYELPDIENV
Ga0209379_1009020523300027758Marine SedimentMGVLFNIFFVIAVIATIVCLCVFLGSLFILFQKNELPDIEDF
Ga0209379_1014463413300027758Marine SedimentWRAIIFRGLLIMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV
Ga0209273_1024965713300027790Marine SedimentMEVLFNILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV
Ga0209578_1029855913300027820Marine SedimentMEVFFKILFVIAVIATVVCLCVFIVALFDAFQKNELPD
Ga0209692_1044025313300027828Marine SedimentGVLFNILFVIAFIAFILCLCVFAVGLFMAFQKNELPDLEDV
Ga0209344_1028275813300027834MarineMEVLLNILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV
Ga0209271_1000237133300027845Marine SedimentMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDI
Ga0209271_1004118223300027845Marine SedimentMELLFKILFVMAFIAFIFCLCVFAGGIFMTFQKNELPDLEDV
Ga0209271_1005775413300027845Marine SedimentMEILFKIFFVIASIGFIFCLCVFIAGVFDAFQKNELPEMEDV
Ga0209345_1020049733300027852MarineMEALFNILFVIAFIAFILCLCVFIAGIFDAFQKNELPEIEDVVVGKGEI
Ga0209013_1000866523300027858MarineMEVLFKILFVIAFIAFIFCLWVFIAGVFDAVQKNELPDIEDV
Ga0209013_1003331373300027858MarineMEVFFKILFVIASVAFIFCLCVFIAGVFDAFQKNELPYMEDV
Ga0209013_1009761733300027858MarineMEVLFKIFFVIAFIAFILCLCVFAAGLFMAFQKNELPDLEDVKTGSNA
(restricted) Ga0233415_1002661833300027861SeawaterMGVLFKILFFVSVIATILCLCVFLGSLFILFQKNELPDIEDV
(restricted) Ga0233415_1009048123300027861SeawaterMEVLFKILFVIAVIATILCLCVFLGSLFILFQKNELPDIEDV
Ga0209272_1009994933300027967Marine SedimentEVLFNILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV
Ga0209272_1027236933300027967Marine SedimentILFVIALIATIFCLCVFIGGLFIAFQKYELPDIENV
(restricted) Ga0233414_1012938213300028045SeawaterMEVLFNILFVVSVISAILCLCMFLDSLFILFQKNELPDIEDV
Ga0307376_1039584113300031578SoilMEGLFKILFVIALIATIFCLCVFFGGLFIAVQKNELPDIEDV
Ga0316187_1019113143300032231Worm BurrowMGVLFNILFVIAVMATIISLCVFLGSLIILFEKDELPDIEDF
Ga0316191_1002547433300032258Worm BurrowMELFFKILFVIAFIALIFCLCVFAGGIFMTFQKNELPDLEDV
Ga0316192_1010982913300032260Worm BurrowLIMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV
Ga0316195_1005340533300032263SedimentMEVLFKILFVIALIAAIFCMRVFMVALFDAFQKNELPDMEDVLIGVG
Ga0316195_1042818213300032263SedimentMEVLFKILFVIALIATIFCLCVFFGGLFIAVQKNELPDIEDV
Ga0316189_1119314513300032272Worm BurrowMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDG
Ga0316193_1032684933300033429SedimentMEVLFKILFLIAFIAFILCLCVFVGGLFMAFKEVELPDLEDV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.