| Basic Information | |
|---|---|
| Family ID | F076109 |
| Family Type | Metagenome |
| Number of Sequences | 118 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MEVLFKILFVIAVIATILCLCVFLGSLFILFQKNELPDIEDV |
| Number of Associated Samples | 63 |
| Number of Associated Scaffolds | 118 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.05 % |
| % of genes near scaffold ends (potentially truncated) | 26.27 % |
| % of genes from short scaffolds (< 2000 bps) | 81.36 % |
| Associated GOLD sequencing projects | 52 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.966 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (27.966 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.593 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Sediment (saline) (42.373 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 118 Family Scaffolds |
|---|---|---|
| PF01381 | HTH_3 | 7.63 |
| PF07238 | PilZ | 7.63 |
| PF14659 | Phage_int_SAM_3 | 2.54 |
| PF00589 | Phage_integrase | 2.54 |
| PF03069 | FmdA_AmdA | 1.69 |
| PF03372 | Exo_endo_phos | 1.69 |
| PF00216 | Bac_DNA_binding | 0.85 |
| PF04545 | Sigma70_r4 | 0.85 |
| PF01663 | Phosphodiest | 0.85 |
| PF02899 | Phage_int_SAM_1 | 0.85 |
| PF02230 | Abhydrolase_2 | 0.85 |
| PF13424 | TPR_12 | 0.85 |
| PF03740 | PdxJ | 0.85 |
| PF12675 | DUF3795 | 0.85 |
| PF12773 | DZR | 0.85 |
| PF01885 | PTS_2-RNA | 0.85 |
| PF02730 | AFOR_N | 0.85 |
| PF04989 | CmcI | 0.85 |
| PF03692 | CxxCxxCC | 0.85 |
| PF13183 | Fer4_8 | 0.85 |
| PF00078 | RVT_1 | 0.85 |
| PF13091 | PLDc_2 | 0.85 |
| COG ID | Name | Functional Category | % Frequency in 118 Family Scaffolds |
|---|---|---|---|
| COG2421 | Acetamidase/formamidase | Energy production and conversion [C] | 1.69 |
| COG0776 | Bacterial nucleoid DNA-binding protein IHF-alpha | Replication, recombination and repair [L] | 0.85 |
| COG0854 | Pyridoxine 5'-phosphate synthase PdxJ | Coenzyme transport and metabolism [H] | 0.85 |
| COG1859 | RNA:NAD 2'-phosphotransferase, TPT1/KptA family | Translation, ribosomal structure and biogenesis [J] | 0.85 |
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.85 |
| COG3510 | Cephalosporin hydroxylase | Defense mechanisms [V] | 0.85 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 0.85 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 0.85 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.81 % |
| Unclassified | root | N/A | 21.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000118|TDF_OR_ARG05_123mDRAFT_c1013428 | Not Available | 676 | Open in IMG/M |
| 3300000122|TDF_OR_ARG04_123mDRAFT_c1006322 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1135 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1001005 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8461 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1006832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3101 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1039513 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1085069 | Not Available | 607 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1113661 | Not Available | 514 | Open in IMG/M |
| 3300000242|TDF_OR_ARG05_123mDRAFT_1119415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 500 | Open in IMG/M |
| 3300000792|BS_KBA_SWE02_21mDRAFT_10119131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 662 | Open in IMG/M |
| 3300001685|JGI24024J18818_10036851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1879 | Open in IMG/M |
| 3300004008|Ga0055446_10165655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 643 | Open in IMG/M |
| 3300004008|Ga0055446_10210748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 581 | Open in IMG/M |
| 3300004023|Ga0055441_10029102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1149 | Open in IMG/M |
| 3300004028|Ga0055447_10207956 | Not Available | 633 | Open in IMG/M |
| 3300004028|Ga0055447_10294683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 549 | Open in IMG/M |
| 3300004029|Ga0055442_10109445 | Not Available | 835 | Open in IMG/M |
| 3300004073|Ga0055516_10049095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 858 | Open in IMG/M |
| 3300004073|Ga0055516_10153688 | Not Available | 563 | Open in IMG/M |
| 3300004147|Ga0055515_10059078 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 893 | Open in IMG/M |
| 3300005214|Ga0069002_10142095 | Not Available | 633 | Open in IMG/M |
| 3300005588|Ga0070728_10021775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 4731 | Open in IMG/M |
| 3300005588|Ga0070728_10131065 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1462 | Open in IMG/M |
| 3300005588|Ga0070728_10425332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 702 | Open in IMG/M |
| 3300005589|Ga0070729_10354019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 819 | Open in IMG/M |
| 3300005589|Ga0070729_10635353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 576 | Open in IMG/M |
| 3300005590|Ga0070727_10727529 | Not Available | 557 | Open in IMG/M |
| 3300005590|Ga0070727_10782437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 535 | Open in IMG/M |
| 3300005601|Ga0070722_10003121 | All Organisms → cellular organisms → Bacteria | 4441 | Open in IMG/M |
| 3300005609|Ga0070724_10099156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1258 | Open in IMG/M |
| 3300005612|Ga0070723_10352410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 704 | Open in IMG/M |
| 3300005612|Ga0070723_10399191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 665 | Open in IMG/M |
| 3300005832|Ga0074469_10038085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 10276 | Open in IMG/M |
| 3300005832|Ga0074469_11269675 | All Organisms → cellular organisms → Bacteria | 5668 | Open in IMG/M |
| 3300005920|Ga0070725_10183333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfosudaceae → Desulfosudis → Desulfosudis oleivorans | 908 | Open in IMG/M |
| 3300005920|Ga0070725_10283193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 727 | Open in IMG/M |
| 3300006467|Ga0099972_10566713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3058 | Open in IMG/M |
| 3300006467|Ga0099972_12596888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1721 | Open in IMG/M |
| 3300006467|Ga0099972_12705314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 601 | Open in IMG/M |
| 3300006467|Ga0099972_12947060 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division Kazan-3B-28 → candidate division Kazan bacterium | 1785 | Open in IMG/M |
| 3300006467|Ga0099972_12959522 | Not Available | 506 | Open in IMG/M |
| 3300006467|Ga0099972_13388304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 3627 | Open in IMG/M |
| 3300008517|Ga0111034_1105041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1806 | Open in IMG/M |
| 3300009509|Ga0123573_10167234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2192 | Open in IMG/M |
| 3300010392|Ga0118731_100611235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1459 | Open in IMG/M |
| 3300010392|Ga0118731_107829769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 657 | Open in IMG/M |
| 3300010392|Ga0118731_108351612 | Not Available | 567 | Open in IMG/M |
| 3300010392|Ga0118731_110246231 | Not Available | 951 | Open in IMG/M |
| 3300010392|Ga0118731_110586740 | Not Available | 589 | Open in IMG/M |
| 3300010392|Ga0118731_113746674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3222 | Open in IMG/M |
| 3300010392|Ga0118731_114145916 | Not Available | 1190 | Open in IMG/M |
| 3300010392|Ga0118731_115634040 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300010412|Ga0136852_10274873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1665 | Open in IMG/M |
| 3300010430|Ga0118733_100146072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4721 | Open in IMG/M |
| 3300010430|Ga0118733_100357672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2892 | Open in IMG/M |
| 3300010430|Ga0118733_105274239 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010430|Ga0118733_105481082 | Not Available | 668 | Open in IMG/M |
| 3300010430|Ga0118733_105952155 | Not Available | 639 | Open in IMG/M |
| 3300010430|Ga0118733_106532526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 608 | Open in IMG/M |
| 3300011118|Ga0114922_10505700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 999 | Open in IMG/M |
| 3300011118|Ga0114922_11455280 | Not Available | 551 | Open in IMG/M |
| 3300011256|Ga0151664_1013740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 590 | Open in IMG/M |
| 3300011257|Ga0151658_1116090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1246 | Open in IMG/M |
| 3300011257|Ga0151658_1211029 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300022201|Ga0224503_10065012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1117 | Open in IMG/M |
| 3300022201|Ga0224503_10136254 | Not Available | 782 | Open in IMG/M |
| 3300022201|Ga0224503_10173573 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 695 | Open in IMG/M |
| 3300022218|Ga0224502_10078413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1247 | Open in IMG/M |
| 3300022307|Ga0224507_10150077 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanococci → Methanococcales → Methanococcaceae → Methanococcus → Methanococcus maripaludis | 928 | Open in IMG/M |
| (restricted) 3300022913|Ga0233404_10076497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 780 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10053449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1187 | Open in IMG/M |
| (restricted) 3300022938|Ga0233409_10154896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 756 | Open in IMG/M |
| (restricted) 3300023085|Ga0233406_10011392 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 981 | Open in IMG/M |
| (restricted) 3300023086|Ga0233407_10044434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 656 | Open in IMG/M |
| (restricted) 3300023089|Ga0233408_10126168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 565 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10150589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1030 | Open in IMG/M |
| (restricted) 3300024519|Ga0255046_10197185 | Not Available | 913 | Open in IMG/M |
| (restricted) 3300024529|Ga0255044_10413850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 564 | Open in IMG/M |
| 3300025557|Ga0210141_1000159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 9816 | Open in IMG/M |
| 3300025557|Ga0210141_1000552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6673 | Open in IMG/M |
| 3300025557|Ga0210141_1011398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1736 | Open in IMG/M |
| 3300025557|Ga0210141_1043123 | Not Available | 861 | Open in IMG/M |
| 3300025564|Ga0210084_1010095 | Not Available | 1711 | Open in IMG/M |
| 3300025564|Ga0210084_1019830 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300025564|Ga0210084_1024930 | Not Available | 1118 | Open in IMG/M |
| 3300025564|Ga0210084_1036225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 938 | Open in IMG/M |
| 3300025977|Ga0210072_1043667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 597 | Open in IMG/M |
| 3300025983|Ga0210106_1086016 | Not Available | 519 | Open in IMG/M |
| 3300026352|Ga0210107_1030915 | Not Available | 815 | Open in IMG/M |
| 3300027742|Ga0209121_10099233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1244 | Open in IMG/M |
| 3300027758|Ga0209379_10021195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2722 | Open in IMG/M |
| 3300027758|Ga0209379_10033689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2036 | Open in IMG/M |
| 3300027758|Ga0209379_10050946 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300027758|Ga0209379_10090205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1114 | Open in IMG/M |
| 3300027758|Ga0209379_10144634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 838 | Open in IMG/M |
| 3300027790|Ga0209273_10249657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 732 | Open in IMG/M |
| 3300027820|Ga0209578_10298559 | Not Available | 749 | Open in IMG/M |
| 3300027828|Ga0209692_10440253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 551 | Open in IMG/M |
| 3300027834|Ga0209344_10282758 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 806 | Open in IMG/M |
| 3300027845|Ga0209271_10002371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 6860 | Open in IMG/M |
| 3300027845|Ga0209271_10041182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1920 | Open in IMG/M |
| 3300027845|Ga0209271_10057754 | All Organisms → cellular organisms → Bacteria | 1614 | Open in IMG/M |
| 3300027852|Ga0209345_10200497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1258 | Open in IMG/M |
| 3300027858|Ga0209013_10008665 | All Organisms → cellular organisms → Bacteria | 8452 | Open in IMG/M |
| 3300027858|Ga0209013_10033313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 3783 | Open in IMG/M |
| 3300027858|Ga0209013_10097617 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1930 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10026618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2326 | Open in IMG/M |
| (restricted) 3300027861|Ga0233415_10090481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1334 | Open in IMG/M |
| 3300027967|Ga0209272_10099949 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300027967|Ga0209272_10272369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 581 | Open in IMG/M |
| (restricted) 3300028045|Ga0233414_10129382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1106 | Open in IMG/M |
| 3300031578|Ga0307376_10395841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 909 | Open in IMG/M |
| 3300032231|Ga0316187_10191131 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1584 | Open in IMG/M |
| 3300032258|Ga0316191_10025474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 4462 | Open in IMG/M |
| 3300032260|Ga0316192_10109829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1932 | Open in IMG/M |
| 3300032263|Ga0316195_10053405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2085 | Open in IMG/M |
| 3300032263|Ga0316195_10428182 | Not Available | 701 | Open in IMG/M |
| 3300032272|Ga0316189_11193145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 575 | Open in IMG/M |
| 3300033429|Ga0316193_10326849 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 1217 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 27.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 17.80% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 11.86% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 7.63% |
| Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 5.93% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 5.08% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 4.24% |
| Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 3.39% |
| Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Sediment | 2.54% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 2.54% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 2.54% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.69% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.69% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.69% |
| Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 1.69% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.85% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.85% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000118 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 06_12.3m | Environmental | Open in IMG/M |
| 3300000122 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site OR sample ARG 04_12.3m | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300000792 | Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 02_21m | Environmental | Open in IMG/M |
| 3300001685 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 | Environmental | Open in IMG/M |
| 3300004008 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 | Environmental | Open in IMG/M |
| 3300004023 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 | Environmental | Open in IMG/M |
| 3300004028 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 | Environmental | Open in IMG/M |
| 3300004029 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordB_D2 | Environmental | Open in IMG/M |
| 3300004073 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordB_D2 | Environmental | Open in IMG/M |
| 3300004147 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_CordA_D2 | Environmental | Open in IMG/M |
| 3300005214 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005589 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005609 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 | Environmental | Open in IMG/M |
| 3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300008517 | Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 175 cmbsf. Combined Assembly of Gp0128389 and Gp0131431 MM4PM4 | Environmental | Open in IMG/M |
| 3300009509 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11 | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300011118 | Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaG | Environmental | Open in IMG/M |
| 3300011256 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total | Environmental | Open in IMG/M |
| 3300011257 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_3, 0.2 | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022218 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022307 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_13 | Environmental | Open in IMG/M |
| 3300022913 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MG | Environmental | Open in IMG/M |
| 3300022938 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MG | Environmental | Open in IMG/M |
| 3300023085 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_5_MG | Environmental | Open in IMG/M |
| 3300023086 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_7_MG | Environmental | Open in IMG/M |
| 3300023089 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MG | Environmental | Open in IMG/M |
| 3300024519 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27 | Environmental | Open in IMG/M |
| 3300024529 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_21 | Environmental | Open in IMG/M |
| 3300025557 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025564 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025977 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025983 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026352 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027758 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027790 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027820 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027828 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027834 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Santa Barbara Oil Seep Sample 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027852 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 7 (SPAdes) | Environmental | Open in IMG/M |
| 3300027858 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300032231 | Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1 | Environmental | Open in IMG/M |
| 3300032258 | Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm | Environmental | Open in IMG/M |
| 3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
| 3300032263 | Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1 | Environmental | Open in IMG/M |
| 3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
| 3300033429 | Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TDF_OR_ARG05_123mDRAFT_10134283 | 3300000118 | Marine | MEVLFKILFFIAFIAFILCLCVFVGGLFMAFKEVELPDLEDV* |
| TDF_OR_ARG04_123mDRAFT_10063223 | 3300000122 | Marine | MEVLFKILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV* |
| TDF_OR_ARG05_123mDRAFT_100100512 | 3300000242 | Marine | MGVLFNILFVIAVIATICCLCVFIGGLFIWFQKNELPDIEDF* |
| TDF_OR_ARG05_123mDRAFT_10068324 | 3300000242 | Marine | MEVLFKILFVIAFIAFILCLCVFAAGLFMAFQKNELPDLEDVKTGSNA* |
| TDF_OR_ARG05_123mDRAFT_10395132 | 3300000242 | Marine | MEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDFDDV* |
| TDF_OR_ARG05_123mDRAFT_10850692 | 3300000242 | Marine | MELLFKILFVIAVIATICCLCVFIGGLFIWFQKNELPDIEDF* |
| TDF_OR_ARG05_123mDRAFT_11136611 | 3300000242 | Marine | MEVLFKILFVIASIAFIFCLCVFITGLFNQKNSSQ |
| TDF_OR_ARG05_123mDRAFT_11194152 | 3300000242 | Marine | MEVFFKILFVIASIAFIFCLCVFITGLFNGFQKNELPDFDDV* |
| BS_KBA_SWE02_21mDRAFT_101191312 | 3300000792 | Marine | MEVLFKILFVIALIATIFCLCVFFGGLFIALQKNELPDIEDV* |
| JGI24024J18818_100368514 | 3300001685 | Marine | MEVLFKILFVIAFIAFIFCLWVFIAGVFDAVQKNELPDIEDV* |
| Ga0055446_101656551 | 3300004008 | Natural And Restored Wetlands | MEVLFKILFVIAFIGFILCLCVFAVGLFMAFQKNELPDLEDV* |
| Ga0055446_102107482 | 3300004008 | Natural And Restored Wetlands | MEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV* |
| Ga0055441_100291021 | 3300004023 | Natural And Restored Wetlands | AIIFRGLLIMEVFFNILFVISVMASIFCLCIFLGNLYILFQKNEFPDIEDV* |
| Ga0055447_102079562 | 3300004028 | Natural And Restored Wetlands | MIMEELFNLFFVISVIATIFCPCVFMGGLLIAFQKSELPDIEDV* |
| Ga0055447_102946832 | 3300004028 | Natural And Restored Wetlands | MEVFFNILFVISVMASIFCLCIFLGNLYILFQKNEFPDIEDV* |
| Ga0055442_101094452 | 3300004029 | Natural And Restored Wetlands | MGVLFNILFVIAVIATIICLCVFLGSLFNLFKKNEILDIEDV* |
| Ga0055516_100490952 | 3300004073 | Natural And Restored Wetlands | MGVLFNILFVIAVIATICCLCVFIGGLFIWFQKNELPDIEEF* |
| Ga0055516_101536881 | 3300004073 | Natural And Restored Wetlands | MGVLFNILFVIAVIATIICLCVFLGSLFNLFKKNEMLDIEDV* |
| Ga0055515_100590781 | 3300004147 | Natural And Restored Wetlands | MEVLFKILIVIAFIGFILCLCVFAVGLFMAFQKNELPDLEDV* |
| Ga0069002_101420952 | 3300005214 | Natural And Restored Wetlands | MEVLFKILFVIAFIAFILCLFVFVGGLFMAFKEVELPDIEDV* |
| Ga0070728_1002177510 | 3300005588 | Marine Sediment | MEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV* |
| Ga0070728_101310652 | 3300005588 | Marine Sediment | MGVLFNILFVIAFIAFILCLCVFAVGLFMAFQKNELPDLEDV* |
| Ga0070728_104253323 | 3300005588 | Marine Sediment | MEVLFNILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV* |
| Ga0070729_103540192 | 3300005589 | Marine Sediment | MELLFKILFVMAFIAFIFCLCVFAGGIFMTFQKNELPDLEDV* |
| Ga0070729_106353532 | 3300005589 | Marine Sediment | MEVFFNILFVIAVIATIFCLCVFMGGLFIVFEKNEFPDIEDV* |
| Ga0070727_107275292 | 3300005590 | Marine Sediment | MEVLFKILFVIASIGFIFCLCVFIAGVFDAFQKNELPEMEDV* |
| Ga0070727_107824371 | 3300005590 | Marine Sediment | FLIAFIAFILCLCVFVSGLFMAFKEVELPDLEDV* |
| Ga0070722_100031216 | 3300005601 | Marine Sediment | MEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDI* |
| Ga0070724_100991561 | 3300005609 | Marine Sediment | MEILFKILFVIAVIATICCLCVFIGGLFIWFQKNELPDIED |
| Ga0070723_103524102 | 3300005612 | Marine Sediment | MEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPD |
| Ga0070723_103991913 | 3300005612 | Marine Sediment | IMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV* |
| Ga0074469_1003808511 | 3300005832 | Sediment (Intertidal) | MEVLFNILFVIAVMASIFCLCIFLGNLFILFQKNELPDIEDV* |
| Ga0074469_112696755 | 3300005832 | Sediment (Intertidal) | MEVLFNILFVIALIATIFCLCVFFGGLFTGFQKNELPDIEDV* |
| Ga0070725_101833331 | 3300005920 | Marine Sediment | ILFVIALIATIFCLCVFIGGLFIAFQKYELPDIENV* |
| Ga0070725_102831933 | 3300005920 | Marine Sediment | LIMEVLFKILFVIAFIAFIFCLCVFAGGIFMTFQKNELPDLKDV* |
| Ga0099972_105667134 | 3300006467 | Marine | MGVLFNIFFVIAVIATIVCLCVFLGSLFILFQKNELPDIEDF* |
| Ga0099972_125968882 | 3300006467 | Marine | MELLFKILFVIAFIAFIFCLCVFAGGIFMTFQKNELPDLEDV* |
| Ga0099972_127053141 | 3300006467 | Marine | LLIMEVLFKMLFVIALIATIFCLCVFMGGLFNAFQKEELPDIEDV* |
| Ga0099972_129470601 | 3300006467 | Marine | MEVLFKILFVIAFIAFILCLCVFAAGLFMAFQKNELPDLEDFKTGSNA* |
| Ga0099972_129595221 | 3300006467 | Marine | MEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEF |
| Ga0099972_133883041 | 3300006467 | Marine | MEVLFKILFVIASIAFIFCLCVFIAGFFDAFQKNKLPNI |
| Ga0111034_11050412 | 3300008517 | Marine Sediment | MIMEVLFNILFVVSVIAAILCLCVFLGSLFILFQKNELPDIEDV* |
| Ga0123573_101672343 | 3300009509 | Mangrove Sediment | MEVFFNILFVVAVIASILCLCIFLGNLLILFEKDEFPDIEDV* |
| Ga0118731_1006112352 | 3300010392 | Marine | MEVLFKMLFVIALIATIFCLCVFMGGLFNAFQKEELPDIEDV* |
| Ga0118731_1078297692 | 3300010392 | Marine | MEVLFKILFLIAFIAFILCLCVFVGGLFMAFKEVELPDLEDV* |
| Ga0118731_1083516121 | 3300010392 | Marine | VLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV* |
| Ga0118731_1102462312 | 3300010392 | Marine | MEVLFKILFVIAFMAFILCLCVFVGGLFMAFKEVELPDIEEVEVSKGILSSNLPS* |
| Ga0118731_1105867401 | 3300010392 | Marine | MEVLFKILFVISVIAAILCLCVFLGSLFILFQKNELPDIE |
| Ga0118731_1137466742 | 3300010392 | Marine | MELLFKILFVMAFIAFIFCLCVFAGGIFMTFQKNELPDLKDV* |
| Ga0118731_1141459161 | 3300010392 | Marine | MEVFFKILFVIASIAFIFCLCVFIAGVFDAVQKNELPDFEDV* |
| Ga0118731_1156340402 | 3300010392 | Marine | MEVLFKILFVIASIAFIFCLCVFIAGFFDAFQKNKLPNIENV* |
| Ga0136852_102748731 | 3300010412 | Mangrove Sediment | MEVFFNILFVIAVIASIFCLCIFLGNLLILFEKDEFPDIEDV* |
| Ga0118733_1001460726 | 3300010430 | Marine Sediment | MEVLFKILFFIALIATIFCLCVFIGGLFIAFQKYELPDIENV* |
| Ga0118733_1003576725 | 3300010430 | Marine Sediment | MELLFKILFVIAFIAFIFCLCVFAGGIFMTFQKNELPDLKDV* |
| Ga0118733_1052742391 | 3300010430 | Marine Sediment | MEVLFKILFVIAFIAFILCLCVFAAGLFMAFQKNELPDLEDVKTG |
| Ga0118733_1054810822 | 3300010430 | Marine Sediment | MEVLFKIFFVIASIGFIFCLCVFIAGVFDAFQKNELPEMEDV |
| Ga0118733_1059521551 | 3300010430 | Marine Sediment | MEVLFKILFVIAFIAFILCLFVFVGGLFMAFKEVELPDMEDV* |
| Ga0118733_1065325261 | 3300010430 | Marine Sediment | MDVLFNILFVIAVIATIFCLCVFMGGLFIVFEKNEFPDFEDVEVSNSG* |
| Ga0114922_105057002 | 3300011118 | Deep Subsurface | MEVLFNILFVVSVIAAILCLCVFLGSLFILFQKNELPDIEDV* |
| Ga0114922_114552802 | 3300011118 | Deep Subsurface | MEVLFNILFVVSVIVAILCLCVFLDSLFILFQKNELPNIEDV* |
| Ga0151664_10137402 | 3300011256 | Marine | MEVLFNILIVIAVIATIICLRVFLGSLLILFQQNELRDIVDV* |
| Ga0151658_11160903 | 3300011257 | Marine | MEVLFKILFVIAFIAFIFCLWVFMGGLFVAFQKNELPDIEDV* |
| Ga0151658_12110291 | 3300011257 | Marine | MGVLFNILFVIAVIATIFCLCVFLGGLFILFEKDELPDIEDF* |
| Ga0224503_100650124 | 3300022201 | Sediment | KILFVIAFIAFILCLFVFVGGLFMAFKEVELPDIEDV |
| Ga0224503_101362541 | 3300022201 | Sediment | MGVLFNILFVIAVIATIICLCVFLGSLFNLFKKNEMLDIEDG |
| Ga0224503_101735732 | 3300022201 | Sediment | MEVFFNILFVISVMASIFCLCIFLGNLYILFQKNEFPDIEDV |
| Ga0224502_100784134 | 3300022218 | Sediment | KILFVFAFIAFILCLFVFVGGLFMAFKEVELPDIEDV |
| Ga0224507_101500773 | 3300022307 | Sediment | MEVLFKILFVIAFIAFILCLFVFVGGLFMAFKEVELPDIED |
| (restricted) Ga0233404_100764972 | 3300022913 | Seawater | MEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV |
| (restricted) Ga0233409_100534491 | 3300022938 | Seawater | MEVLFKILFVIALIATIFCLCVFMAGAFIAFQKNELPDIDDL |
| (restricted) Ga0233409_101548962 | 3300022938 | Seawater | MEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV |
| (restricted) Ga0233406_100113924 | 3300023085 | Seawater | IMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV |
| (restricted) Ga0233407_100444342 | 3300023086 | Seawater | MEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDLEDV |
| (restricted) Ga0233408_101261681 | 3300023089 | Seawater | MEVVFNILFVVSVISAILCLCMFLDSLFIAFQKNELPDIEDV |
| (restricted) Ga0255046_101505892 | 3300024519 | Seawater | MGVLFNILFVVAVIAIIICLCVFLGGLFILFEKNELPDMEDV |
| (restricted) Ga0255046_101971852 | 3300024519 | Seawater | MEVFFNILFVIAVIATIFCLCVFMGGLFIVLEKNEFPDIEDV |
| (restricted) Ga0255044_104138502 | 3300024529 | Seawater | TIIFRGLLIMEVLFKILFVIALIATIFCLCVFIGGLFIAFQKYELPDIENV |
| Ga0210141_10001593 | 3300025557 | Natural And Restored Wetlands | MEVLFKILFVIAFIAFILCLFVFVGGLFMAFQKNELPDLEDV |
| Ga0210141_10005528 | 3300025557 | Natural And Restored Wetlands | MEVLFKILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV |
| Ga0210141_10113982 | 3300025557 | Natural And Restored Wetlands | MEVLFKILFVIAFIGFILCLCVFAVGLFMAFQKNELPDLEDV |
| Ga0210141_10431232 | 3300025557 | Natural And Restored Wetlands | MEELFNLFFVISVIATIFCPCVFMGGLLIAFQKSELPDIEDV |
| Ga0210084_10100953 | 3300025564 | Natural And Restored Wetlands | MEVLFKILFVVAFIGFILCLCVFAVGLFMAFQKNELPDLEDV |
| Ga0210084_10198302 | 3300025564 | Natural And Restored Wetlands | MEVIFNIMFFVSVIAAIFCLCVFLGSLFILFQKNELPDIEDV |
| Ga0210084_10249301 | 3300025564 | Natural And Restored Wetlands | MGVLFSILFVIAVIATIICLCVFLGSLFNLFKKNEMLDIEDG |
| Ga0210084_10362251 | 3300025564 | Natural And Restored Wetlands | MEVLFKILFFVSVVAAILCLCVFLGSLFILFQKNELPDIEDV |
| Ga0210072_10436672 | 3300025977 | Natural And Restored Wetlands | MEVLFKIFFVIAFIAFILCMFVFVGGLFMAFKEVELPDIEDV |
| Ga0210106_10860161 | 3300025983 | Natural And Restored Wetlands | MEVLFKMLFVIALIATIFCLCVFIGGLFNAFQKEE |
| Ga0210107_10309152 | 3300026352 | Natural And Restored Wetlands | MGVLFNILFVIAVIATIICLCVFLGSLFNLFKKNEMLDIEDV |
| Ga0209121_100992331 | 3300027742 | Marine | MEALFNILFVIAFIAFILCLCVFIAGIFDAFQKNELPEIEYVVVGKGEI |
| Ga0209379_100211951 | 3300027758 | Marine Sediment | FRGLLIMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV |
| Ga0209379_100336893 | 3300027758 | Marine Sediment | MEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDME |
| Ga0209379_100509461 | 3300027758 | Marine Sediment | MEVLFKILFVIALIATIFCLCVFIGGLFIAFQKYELPDIENV |
| Ga0209379_100902052 | 3300027758 | Marine Sediment | MGVLFNIFFVIAVIATIVCLCVFLGSLFILFQKNELPDIEDF |
| Ga0209379_101446341 | 3300027758 | Marine Sediment | WRAIIFRGLLIMEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDV |
| Ga0209273_102496571 | 3300027790 | Marine Sediment | MEVLFNILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV |
| Ga0209578_102985591 | 3300027820 | Marine Sediment | MEVFFKILFVIAVIATVVCLCVFIVALFDAFQKNELPD |
| Ga0209692_104402531 | 3300027828 | Marine Sediment | GVLFNILFVIAFIAFILCLCVFAVGLFMAFQKNELPDLEDV |
| Ga0209344_102827581 | 3300027834 | Marine | MEVLLNILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV |
| Ga0209271_100023713 | 3300027845 | Marine Sediment | MEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDI |
| Ga0209271_100411822 | 3300027845 | Marine Sediment | MELLFKILFVMAFIAFIFCLCVFAGGIFMTFQKNELPDLEDV |
| Ga0209271_100577541 | 3300027845 | Marine Sediment | MEILFKIFFVIASIGFIFCLCVFIAGVFDAFQKNELPEMEDV |
| Ga0209345_102004973 | 3300027852 | Marine | MEALFNILFVIAFIAFILCLCVFIAGIFDAFQKNELPEIEDVVVGKGEI |
| Ga0209013_100086652 | 3300027858 | Marine | MEVLFKILFVIAFIAFIFCLWVFIAGVFDAVQKNELPDIEDV |
| Ga0209013_100333137 | 3300027858 | Marine | MEVFFKILFVIASVAFIFCLCVFIAGVFDAFQKNELPYMEDV |
| Ga0209013_100976173 | 3300027858 | Marine | MEVLFKIFFVIAFIAFILCLCVFAAGLFMAFQKNELPDLEDVKTGSNA |
| (restricted) Ga0233415_100266183 | 3300027861 | Seawater | MGVLFKILFFVSVIATILCLCVFLGSLFILFQKNELPDIEDV |
| (restricted) Ga0233415_100904812 | 3300027861 | Seawater | MEVLFKILFVIAVIATILCLCVFLGSLFILFQKNELPDIEDV |
| Ga0209272_100999493 | 3300027967 | Marine Sediment | EVLFNILFFVSVIAAILCLCVFLGSLFILFQKNELPDIEDV |
| Ga0209272_102723693 | 3300027967 | Marine Sediment | ILFVIALIATIFCLCVFIGGLFIAFQKYELPDIENV |
| (restricted) Ga0233414_101293821 | 3300028045 | Seawater | MEVLFNILFVVSVISAILCLCMFLDSLFILFQKNELPDIEDV |
| Ga0307376_103958411 | 3300031578 | Soil | MEGLFKILFVIALIATIFCLCVFFGGLFIAVQKNELPDIEDV |
| Ga0316187_101911314 | 3300032231 | Worm Burrow | MGVLFNILFVIAVMATIISLCVFLGSLIILFEKDELPDIEDF |
| Ga0316191_100254743 | 3300032258 | Worm Burrow | MELFFKILFVIAFIALIFCLCVFAGGIFMTFQKNELPDLEDV |
| Ga0316192_101098291 | 3300032260 | Worm Burrow | LIMEVLFKILFVIAFIAFILCLCVFVGGLFMAFKEVELPDMEDV |
| Ga0316195_100534053 | 3300032263 | Sediment | MEVLFKILFVIALIAAIFCMRVFMVALFDAFQKNELPDMEDVLIGVG |
| Ga0316195_104281821 | 3300032263 | Sediment | MEVLFKILFVIALIATIFCLCVFFGGLFIAVQKNELPDIEDV |
| Ga0316189_111931451 | 3300032272 | Worm Burrow | MEVFFNILFVIAVMASIFCLCIFLGNLYILFQKNEFPDIEDG |
| Ga0316193_103268493 | 3300033429 | Sediment | MEVLFKILFLIAFIAFILCLCVFVGGLFMAFKEVELPDLEDV |
| ⦗Top⦘ |