Metagenome / Metatranscriptome Family F071368

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F071368
Family Type	Metagenome / Metatranscriptome
Number of Sequences	122
Average Sequence Length	45 residues
Representative Sequence	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP
Number of Associated Samples	80
Number of Associated Scaffolds	122

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	9.02 %
% of genes near scaffold ends (potentially truncated)	18.85 %
% of genes from short scaffolds (< 2000 bps)	84.43 %
Associated GOLD sequencing projects	71
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (42.623 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (45.902 % of family members)
Environment Ontology (ENVO)	Unclassified (93.443 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (53.279 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 122 Family Scaffolds
PF10124	Mu-like_gpT	24.59
PF05521	Phage_H_T_join	14.75
PF11367	DUF3168	3.28
PF04883	HK97-gp10_like	2.46
PF01432	Peptidase_M3	0.82
PF09956	DUF2190	0.82
PF02195	ParBc	0.82

COG ID	Name	Functional Category	% Frequency in 122 Family Scaffolds
COG0339	Zn-dependent oligopeptidase, M3 family	Posttranslational modification, protein turnover, chaperones [O]	0.82
COG1164	Oligoendopeptidase F	Amino acid transport and metabolism [E]	0.82

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	46.72 %
Unclassified	root	N/A	31.15 %
Methanogenium	genus	Methanogenium	22.13 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	45.08 %
Unclassified	root	N/A	31.15 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Viruses	superkingdom	All Organisms → Viruses	1.64 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	42.62 %
Unclassified	root	N/A	31.15 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.64 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	31.15 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	22.95 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.64 %
unclassified Bacteria	no rank	All Organisms → cellular organisms → Bacteria → unclassified Bacteria	0.82 %
Synergistetes	phylum	All Organisms → cellular organisms → Bacteria → Synergistetes	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	31.15 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	7.38 %
Stenosarchaea group	clade	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.64 %
Synergistia	class	All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia	0.82 %
bacterium ADurb.BinA028	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	31.15 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	3.28 %
Methanomicrobia	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	2.46 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.64 %
Synergistales	order	All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales	0.82 %
bacterium ADurb.BinA028	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	31.15 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	1.64 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.64 %
Methanomicrobiales	order	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales	0.82 %
Synergistaceae	family	All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae	0.82 %
bacterium ADurb.BinA028	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	31.15 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	1.64 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.64 %
unclassified Methanomicrobiales	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales	0.82 %
unclassified Synergistaceae	no rank	All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → unclassified Synergistaceae	0.82 %
bacterium ADurb.BinA028	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	31.15 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Salinispora	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora	1.64 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.64 %
Synergistaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → unclassified Synergistaceae → Synergistaceae bacterium	0.82 %
Methanomicrobiales archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon	0.82 %
bacterium ADurb.BinA028	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028	0.82 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	31.15 %
Methanogenium cariaci	species	Methanogenium → Methanogenium cariaci	22.13 %
Salinispora arenicola	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora arenicola	1.64 %
Actinomycetales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	1.64 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	1.64 %
Synergistaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → unclassified Synergistaceae → Synergistaceae bacterium	0.82 %
Methanomicrobiales archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon	0.82 %
bacterium ADurb.BinA028	species	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028	0.82 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002163\|JGI24707J26582_10130529	All Organisms → cellular organisms → Bacteria → Terrabacteria group	713	Open in IMG/M
3300002163\|JGI24707J26582_10158027	Not Available	618	Open in IMG/M
3300002163\|JGI24707J26582_10196598	All Organisms → cellular organisms → Bacteria → Terrabacteria group	527	Open in IMG/M
3300002164\|JGI24708J26588_10050102	Not Available	1555	Open in IMG/M
3300002164\|JGI24708J26588_10095596	All Organisms → cellular organisms → Bacteria → Terrabacteria group	904	Open in IMG/M
3300002166\|JGI24713J26584_10075599	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	712	Open in IMG/M
3300002166\|JGI24713J26584_10104147	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales	548	Open in IMG/M
3300002168\|JGI24712J26585_10220312	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora arenicola	516	Open in IMG/M
3300002173\|JGI24709J26583_10049933	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1683	Open in IMG/M
3300002174\|JGI24710J26742_10165617	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	666	Open in IMG/M
3300002378\|JGI24502J29692_10065845	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1082	Open in IMG/M
3300002406\|JGI24499J29688_1014169	Methanogenium → Methanogenium cariaci	563	Open in IMG/M
3300002596\|draft_1419371	Not Available	8981	Open in IMG/M
3300002837\|bg3kmer60_1105172	Methanogenium → Methanogenium cariaci	530	Open in IMG/M
3300002837\|bg3kmer60_1109639	All Organisms → cellular organisms → Bacteria → Terrabacteria group	512	Open in IMG/M
3300002898\|draft_10481623	Methanogenium → Methanogenium cariaci	553	Open in IMG/M
3300003306\|Ga0004534J46558_1006136	All Organisms → cellular organisms → Bacteria	1001	Open in IMG/M
3300003306\|Ga0004534J46558_1008739	Not Available	683	Open in IMG/M
3300003306\|Ga0004534J46558_1013679	Methanogenium → Methanogenium cariaci	570	Open in IMG/M
3300003306\|Ga0004534J46558_1021939	All Organisms → cellular organisms → Bacteria → Terrabacteria group	569	Open in IMG/M
3300005835\|Ga0078910_102495	Methanogenium → Methanogenium cariaci	4032	Open in IMG/M
3300005835\|Ga0078910_106781	Methanogenium → Methanogenium cariaci	1178	Open in IMG/M
3300005835\|Ga0078910_119751	Not Available	1004	Open in IMG/M
3300006225\|Ga0082206_101995	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon	5206	Open in IMG/M
3300006360\|Ga0079079_1192328	Methanogenium → Methanogenium cariaci	1622	Open in IMG/M
3300006376\|Ga0079101_1334014	Not Available	520	Open in IMG/M
3300006381\|Ga0079102_1387104	Methanogenium → Methanogenium cariaci	2097	Open in IMG/M
3300006386\|Ga0079068_1314520	Not Available	564	Open in IMG/M
3300006388\|Ga0079062_1429858	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300006395\|Ga0079066_1539394	Not Available	754	Open in IMG/M
3300006483\|Ga0100240_112171	All Organisms → cellular organisms → Bacteria	7065	Open in IMG/M
3300006594\|Ga0079073_1017349	Not Available	672	Open in IMG/M
3300006594\|Ga0079073_1018233	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1162	Open in IMG/M
3300006596\|Ga0079074_1280935	All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → unclassified Synergistaceae → Synergistaceae bacterium	1490	Open in IMG/M
3300006600\|Ga0079065_1003023	All Organisms → cellular organisms → Bacteria	1633	Open in IMG/M
3300006801\|Ga0079223_10213362	Methanogenium → Methanogenium cariaci	1200	Open in IMG/M
3300006801\|Ga0079223_10536867	All Organisms → cellular organisms → Bacteria → Terrabacteria group	733	Open in IMG/M
3300006840\|Ga0101790_125508	All Organisms → cellular organisms → Bacteria	4236	Open in IMG/M
3300009121\|Ga0118671_1027065	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1768	Open in IMG/M
3300009121\|Ga0118671_1109227	All Organisms → cellular organisms → Bacteria	717	Open in IMG/M
3300009362\|Ga0118673_1131728	Not Available	672	Open in IMG/M
3300009607\|Ga0123327_1042947	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1916	Open in IMG/M
3300009642\|Ga0123331_1039219	All Organisms → Viruses → Predicted Viral	1727	Open in IMG/M
3300009647\|Ga0123326_1261691	Not Available	519	Open in IMG/M
3300009657\|Ga0116179_1181587	Methanogenium → Methanogenium cariaci	720	Open in IMG/M
3300009658\|Ga0116188_1080547	All Organisms → cellular organisms → Bacteria	1349	Open in IMG/M
3300009664\|Ga0116146_1301398	Methanogenium → Methanogenium cariaci	604	Open in IMG/M
3300009666\|Ga0116182_1028789	All Organisms → cellular organisms → Bacteria	3484	Open in IMG/M
3300009667\|Ga0116147_1102228	All Organisms → Viruses → Predicted Viral	1222	Open in IMG/M
3300009668\|Ga0116180_1261556	All Organisms → cellular organisms → Bacteria → Terrabacteria group	655	Open in IMG/M
3300009669\|Ga0116148_1066896	All Organisms → cellular organisms → Bacteria	1893	Open in IMG/M
3300009670\|Ga0116183_1245107	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora arenicola	806	Open in IMG/M
3300009671\|Ga0123334_1071712	Methanogenium → Methanogenium cariaci	1850	Open in IMG/M
3300009680\|Ga0123335_1198264	Not Available	1038	Open in IMG/M
3300009682\|Ga0116172_10135323	All Organisms → cellular organisms → Bacteria	1343	Open in IMG/M
3300009682\|Ga0116172_10258271	Methanogenium → Methanogenium cariaci	868	Open in IMG/M
3300009685\|Ga0116142_10200973	All Organisms → cellular organisms → Bacteria	1018	Open in IMG/M
3300009696\|Ga0116177_10430762	Not Available	692	Open in IMG/M
3300009707\|Ga0116195_1006418	All Organisms → cellular organisms → Bacteria	4584	Open in IMG/M
3300009707\|Ga0116195_1098246	All Organisms → cellular organisms → Bacteria	574	Open in IMG/M
3300009715\|Ga0116160_1087509	Methanogenium → Methanogenium cariaci	1372	Open in IMG/M
3300009767\|Ga0116161_1157239	Methanogenium → Methanogenium cariaci	1013	Open in IMG/M
3300009767\|Ga0116161_1426631	Methanogenium → Methanogenium cariaci	510	Open in IMG/M
3300009781\|Ga0116178_10065213	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2023	Open in IMG/M
3300009781\|Ga0116178_10549047	Not Available	560	Open in IMG/M
3300010340\|Ga0116250_10201527	Methanogenium → Methanogenium cariaci	1221	Open in IMG/M
3300010340\|Ga0116250_10213669	Methanogenium → Methanogenium cariaci	1177	Open in IMG/M
3300010340\|Ga0116250_10224522	Not Available	1141	Open in IMG/M
3300010340\|Ga0116250_10760323	All Organisms → cellular organisms → Bacteria → Terrabacteria group	525	Open in IMG/M
3300010355\|Ga0116242_10062022	All Organisms → cellular organisms → Bacteria	4263	Open in IMG/M
3300010357\|Ga0116249_10875864	Not Available	816	Open in IMG/M
3300010357\|Ga0116249_11756406	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300012881\|Ga0079063_1010648	All Organisms → cellular organisms → Bacteria	1908	Open in IMG/M
3300014203\|Ga0172378_10298476	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1241	Open in IMG/M
3300014203\|Ga0172378_10336130	Methanogenium → Methanogenium cariaci	1154	Open in IMG/M
3300014203\|Ga0172378_10490242	Not Available	918	Open in IMG/M
3300014204\|Ga0172381_10592739	Not Available	848	Open in IMG/M
3300014204\|Ga0172381_11339789	Not Available	518	Open in IMG/M
3300014206\|Ga0172377_10400744	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1138	Open in IMG/M
3300014206\|Ga0172377_10933467	Not Available	673	Open in IMG/M
3300014206\|Ga0172377_11236153	Not Available	567	Open in IMG/M
3300015214\|Ga0172382_10264228	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1375	Open in IMG/M
3300015214\|Ga0172382_10351872	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1132	Open in IMG/M
3300015214\|Ga0172382_10659525	All Organisms → cellular organisms → Bacteria → Terrabacteria group	737	Open in IMG/M
3300015214\|Ga0172382_10782278	Not Available	656	Open in IMG/M
3300015214\|Ga0172382_11124690	Not Available	513	Open in IMG/M
3300019222\|Ga0179957_1223385	All Organisms → cellular organisms → Bacteria	659	Open in IMG/M
3300025408\|Ga0208462_1011495	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2277	Open in IMG/M
3300025618\|Ga0208693_1050520	Methanogenium → Methanogenium cariaci	1432	Open in IMG/M
3300025618\|Ga0208693_1076062	Methanogenium → Methanogenium cariaci	1031	Open in IMG/M
3300025618\|Ga0208693_1137117	Not Available	637	Open in IMG/M
3300025657\|Ga0208823_1041415	All Organisms → cellular organisms → Bacteria	1817	Open in IMG/M
3300025657\|Ga0208823_1054573	All Organisms → cellular organisms → Bacteria	1460	Open in IMG/M
3300025657\|Ga0208823_1122706	All Organisms → cellular organisms → Bacteria → Terrabacteria group	761	Open in IMG/M
3300025677\|Ga0209719_1028104	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	2374	Open in IMG/M
3300025682\|Ga0209718_1026952	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	2632	Open in IMG/M
3300025708\|Ga0209201_1033244	All Organisms → cellular organisms → Bacteria → Terrabacteria group	2390	Open in IMG/M
3300025708\|Ga0209201_1043313	All Organisms → cellular organisms → Bacteria	1962	Open in IMG/M
3300025708\|Ga0209201_1176302	Not Available	676	Open in IMG/M
3300025714\|Ga0208458_1101433	Not Available	1019	Open in IMG/M
3300025859\|Ga0209096_1231024	Not Available	687	Open in IMG/M
3300025871\|Ga0209311_1070822	Methanogenium → Methanogenium cariaci	1618	Open in IMG/M
3300025871\|Ga0209311_1234170	Not Available	717	Open in IMG/M
3300026194\|Ga0209509_1073946	Not Available	833	Open in IMG/M
3300026195\|Ga0209312_1125177	Methanogenium → Methanogenium cariaci	630	Open in IMG/M
3300026198\|Ga0209313_1122503	Not Available	561	Open in IMG/M
3300026252\|Ga0209722_1034429	Methanogenium → Methanogenium cariaci	1887	Open in IMG/M
3300026252\|Ga0209722_1105161	Not Available	820	Open in IMG/M
3300027510\|Ga0209537_1001011	Not Available	32913	Open in IMG/M
3300027510\|Ga0209537_1019944	Methanogenium → Methanogenium cariaci	3153	Open in IMG/M
(restricted) 3300028561\|Ga0255343_1057388	All Organisms → cellular organisms → Bacteria	1916	Open in IMG/M
(restricted) 3300028568\|Ga0255345_1184027	Not Available	859	Open in IMG/M
(restricted) 3300028593\|Ga0255347_1260418	Not Available	754	Open in IMG/M
(restricted) 3300028593\|Ga0255347_1328634	Not Available	626	Open in IMG/M
3300028602\|Ga0265294_10106952	Methanogenium → Methanogenium cariaci	2223	Open in IMG/M
3300028602\|Ga0265294_10310444	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1045	Open in IMG/M
3300028602\|Ga0265294_10831660	Not Available	509	Open in IMG/M
3300028603\|Ga0265293_10713733	Methanogenium → Methanogenium cariaci	535	Open in IMG/M
3300029667\|Ga0307354_103258	All Organisms → cellular organisms → Bacteria	2061	Open in IMG/M
3300029673\|Ga0307355_118453	Not Available	784	Open in IMG/M
3300029822\|Ga0134854_1010014	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028	3908	Open in IMG/M
3300029824\|Ga0134852_101369	Not Available	1408	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Engineered	Engineered	93.44%
Environmental	Environmental	6.56%

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	49.18%
Biotransformation	Engineered → Biotransformation	16.39%
Bioreactor	Engineered → Bioreactor	13.93%
Solid Waste	Engineered → Solid Waste	9.84%
Aquatic	Environmental → Aquatic	4.92%
Built Environment	Engineered → Built Environment	3.28%
Terrestrial	Environmental → Terrestrial	1.64%
Unclassified	Engineered → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	48.36%
Mixed Alcohol Bioreactor	Engineered → Biotransformation → Mixed Alcohol Bioreactor	14.75%
Landfill	Engineered → Solid Waste → Landfill	9.02%
Anaerobic	Engineered → Bioreactor → Anaerobic	8.20%
Freshwater	Environmental → Aquatic → Freshwater	4.92%
Continuous Culture	Engineered → Bioreactor → Continuous Culture	4.10%
Water Treatment Plant	Engineered → Built Environment → Water Treatment Plant	3.28%
Soil	Environmental → Terrestrial → Soil	1.64%
Unclassified	Engineered → Bioreactor → Unclassified	1.64%
Unclassified	Engineered → Biotransformation → Unclassified	1.64%
Animal Waste	Engineered → Solid Waste → Animal Waste	0.82%
Industrial Wastewater	Engineered → Wastewater → Industrial Wastewater	0.82%
Unclassified	Engineered → Unclassified → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	48.36%
Unclassified	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified	14.75%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified	9.02%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	8.20%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	4.92%
Marine Sediment Inoculum	Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum	4.10%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified	3.28%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.64%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	1.64%
Unclassified	Engineered → Biotransformation → Unclassified → Unclassified	1.64%
Unclassified	Engineered → Solid Waste → Animal Waste → Unclassified	0.82%
Petrochemical	Engineered → Wastewater → Industrial Wastewater → Petrochemical	0.82%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	48.36%
Unclassified	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified	14.75%
Unclassified	Engineered → Solid Waste → Landfill → Unclassified → Unclassified	9.02%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	8.20%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	4.92%
Unclassified	Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified	4.10%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified	3.28%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.64%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	1.64%
Unclassified	Engineered → Biotransformation → Unclassified → Unclassified → Unclassified	1.64%
Unclassified	Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified	0.82%
Unclassified	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified	0.82%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified → Unclassified	0.82%

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	45.90%
Biogas Fermentantion	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion	14.75%
Landfill Leachate	Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate	9.02%
Anaerobic Biogas Reactor	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor	8.20%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater	4.92%
Wastewater	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater	3.28%
Anaerobic Wastewater Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge	2.46%
Biogas Reactor	Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor	2.46%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil	1.64%
Fermentation Pit Mud	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud	1.64%
Biogas Reactor	Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor	1.64%
Manure	Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure	0.82%
Hydrocarbon Resource Environments	Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments	0.82%
Biogas Fermenter	Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter	0.82%
Anaerobic Reactor	Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Anaerobic Reactor	0.82%
Mixed Substrate Biogas Reactor	Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor	0.82%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002163	Biogas fermentation microbial communities from Germany - Plant 1 DNA1	Engineered	Open in IMG/M
3300002164	Biogas fermentation microbial communities from Germany - Plant 1 DNA2	Engineered	Open in IMG/M
3300002166	Biogas fermentation microbial communities from Germany - Plant 4 DNA1	Engineered	Open in IMG/M
3300002168	Biogas fermentation microbial communities from Germany - Plant 3 DNA2	Engineered	Open in IMG/M
3300002173	Biogas fermentation microbial communities from Germany - Plant 2 DNA1	Engineered	Open in IMG/M
3300002174	Biogas fermentation microbial communities from Germany - Plant 2 DNA2	Engineered	Open in IMG/M
3300002378	Biogas fermentation microbial communities from Germany - Plant 3 RNA1 (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300002406	Biogas fermentation microbial communities from Germany - Plant 1 RNA2 (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300002596	Hydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10	Engineered	Open in IMG/M
3300002837	Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer	Engineered	Open in IMG/M
3300002898	Metagenome Biopara biogasfermenter May 2013 pooled	Engineered	Open in IMG/M
3300003306	Biogas fermentation microbial communities from Germany - Plant 1 RNA1 (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300005835	Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads	Engineered	Open in IMG/M
3300006225	Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy	Engineered	Open in IMG/M
3300006360	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Val_03_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006376	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1013_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006381	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006386	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_01_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006388	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_01_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006395	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006483	Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture C4	Engineered	Open in IMG/M
3300006594	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_03_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006596	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Leu_01_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006600	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_01_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300006801	Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011	Environmental	Open in IMG/M
3300006840	Anaerobic bioreactor microbial communities from Canach, Luxembourg	Engineered	Open in IMG/M
3300009121	Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.A IDBA	Engineered	Open in IMG/M
3300009362	Syntrophic microbial communities from biogas reactors - R1.C13.But.A IBDA	Engineered	Open in IMG/M
3300009607	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA	Engineered	Open in IMG/M
3300009642	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA	Engineered	Open in IMG/M
3300009647	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA	Engineered	Open in IMG/M
3300009657	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG	Engineered	Open in IMG/M
3300009658	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG	Engineered	Open in IMG/M
3300009664	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG	Engineered	Open in IMG/M
3300009666	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG	Engineered	Open in IMG/M
3300009667	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG	Engineered	Open in IMG/M
3300009668	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG	Engineered	Open in IMG/M
3300009669	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG	Engineered	Open in IMG/M
3300009670	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG	Engineered	Open in IMG/M
3300009671	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA	Engineered	Open in IMG/M
3300009680	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA	Engineered	Open in IMG/M
3300009682	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG	Engineered	Open in IMG/M
3300009685	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG	Engineered	Open in IMG/M
3300009696	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG	Engineered	Open in IMG/M
3300009707	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG	Engineered	Open in IMG/M
3300009715	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG	Engineered	Open in IMG/M
3300009767	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG	Engineered	Open in IMG/M
3300009781	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG	Engineered	Open in IMG/M
3300010340	AD_USOAca	Engineered	Open in IMG/M
3300010355	AD_USDVca	Engineered	Open in IMG/M
3300010357	AD_USSTca	Engineered	Open in IMG/M
3300012881	Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_02_SludgeMetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300014203	Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG	Environmental	Open in IMG/M
3300014204	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG	Engineered	Open in IMG/M
3300014206	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG	Engineered	Open in IMG/M
3300015214	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG	Engineered	Open in IMG/M
3300019222	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300025408	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU001_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025618	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025657	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025677	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025682	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025708	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025714	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025859	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025871	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes)	Engineered	Open in IMG/M
3300026194	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300026195	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300026198	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300026252	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300027510	Biogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes)	Engineered	Open in IMG/M
3300028561 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16	Engineered	Open in IMG/M
3300028568 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20	Engineered	Open in IMG/M
3300028593 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24	Engineered	Open in IMG/M
3300028602	Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3	Environmental	Open in IMG/M
3300028603	Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R	Engineered	Open in IMG/M
3300029667	Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Trp1 (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300029673	Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Trp2 (Metagenome Metatranscriptome)	Engineered	Open in IMG/M
3300029822	Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T	Engineered	Open in IMG/M
3300029824	Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-1-30-B	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24707J26582_101305291	3300002163	Biogas Fermentantion	MDRLPHPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK*
JGI24707J26582_101580272	3300002163	Biogas Fermentantion	MDSLPSPVTTTDVYLARIVEQNDEIIALLKTGGERPKTRRLKEPKP*
JGI24707J26582_101965981	3300002163	Biogas Fermentantion	MDDLPRPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLK
JGI24708J26588_100501022	3300002164	Biogas Fermentantion	MDDLPRPVTTTDAYLARIVEQNDEIIALMKTGGGRPKTRRLKEPKP*
JGI24708J26588_100955962	3300002164	Biogas Fermentantion	MDSLPSPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP*
JGI24713J26584_100755992	3300002166	Biogas Fermentantion	MDSLPSPVTTMDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP*
JGI24713J26584_101041472	3300002166	Biogas Fermentantion	MDSLPRPVTTTDVYLARIVEQNDEIIALIKTEGARPKTRRLKEPKP*
JGI24712J26585_102203122	3300002168	Biogas Fermentantion	MDNLPRPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK*
JGI24709J26583_100499332	3300002173	Biogas Fermentantion	MDNLPHPVTTTEIYLARIVQQNDEIIALMKTGGARPKTRRLKEPKP*
JGI24710J26742_101656172	3300002174	Biogas Fermentantion	MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP*
JGI24502J29692_100658452	3300002378	Biogas Fermentantion	MDNLPRPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP*
JGI24499J29688_10141691	3300002406	Biogas Fermentantion	MDSLPSPVTTTDVYLARIVEQNDEIIALLNQQRATTKPRRLKEPKK*
draft_141937111	3300002596	Hydrocarbon Resource Environments	MDSLPHPVTATDAYLARIVQQNDEIIALMKTLGERPKTRRLKEPKP*
bg3kmer60_11051722	3300002837	Biogas Reactor	VITMDNLPHPVTTTEIYLARIVQQNDEIIGLLNQQRPAAKPRRLKEPKP*
bg3kmer60_11096391	3300002837	Biogas Reactor	MVSLPRPVTTTDAYLARIVEQNDEIIALMKTGGERPKTRRLKEPKP*
draft_104816231	3300002898	Biogas Fermenter	MDSLPHPVTATDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK*
Ga0004534J46558_10061362	3300003306	Biogas Fermentantion	MDRLPHPVTTTDAYLARIVEQNDEIIALMKTGGERPKTRRLKEPKP*
Ga0004534J46558_10087391	3300003306	Biogas Fermentantion	MDSLPSPVTTTDVYLARIVEQNDEIIALMKTGGERPKTRRLKEPKP*
Ga0004534J46558_10136791	3300003306	Biogas Fermentantion	MDSLPHPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK*
Ga0004534J46558_10219392	3300003306	Biogas Fermentantion	MDSLPSPVTTTDVYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK*
Ga0078910_1024952	3300005835	Biogas Reactor	MDRLPHPVTATDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK*
Ga0078910_1067813	3300005835	Biogas Reactor	MDNLPHPVTATDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK*
Ga0078910_1197512	3300005835	Biogas Reactor	MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGGRPKTRRLKEPKP*
Ga0082206_1019952	3300006225	Mixed Substrate Biogas Reactor	MDSLPRPVTTTDAYLARIVEQNDEIIALMKTWGERPKTRRLKEPKP*
Ga0079079_11923284	3300006360	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0079101_13340142	3300006376	Anaerobic Digestor Sludge	VIYMDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0079102_13871044	3300006381	Anaerobic Digestor Sludge	MDDLPHPVTTTEIYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP*
Ga0079068_13145202	3300006386	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPR
Ga0079062_14298582	3300006388	Anaerobic Digestor Sludge	MDDLPRPVTTTEIYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0079066_15393942	3300006395	Anaerobic Digestor Sludge	MDNLPHPVTTTEIYLARIVQQNDEIIALLNQQRPAPKPR
Ga0100240_1121715	3300006483	Manure	MDSLPRPVTTTDAYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP*
Ga0079073_10173492	3300006594	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRR
Ga0079073_10182332	3300006594	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRL
Ga0079074_12809354	3300006596	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEIIALMKTEGVRPKPRRLKEPKP*
Ga0079065_10030231	3300006600	Anaerobic Digestor Sludge	MDDLPHPVTTTEIYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP
Ga0079223_102133624	3300006801	Agricultural Soil	MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGVRPKTRRLKEPKP*
Ga0079223_105368671	3300006801	Agricultural Soil	MDSLPSPVTTMDVYLARIVEQNDEIIALLNQQRATTKPRRLKEPKK*
Ga0101790_1255083	3300006840	Anaerobic Reactor	MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP*
Ga0118671_10270656	3300009121	Anaerobic Wastewater Sludge	VIIMDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP*
Ga0118671_11092272	3300009121	Anaerobic Wastewater Sludge	MDSLPRPVTTTDAYLARIVDQNDEIIALMKAEGERPKTRRLKEPKP*
Ga0118673_11317281	3300009362	Anaerobic Wastewater Sludge	IYMDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE*
Ga0123327_10429473	3300009607	Anaerobic Biogas Reactor	MDDLPHPVTTTDTYLARIVSQNDEIIAPLNQQRPEPKQPRRLKEPKE*
Ga0123331_10392194	3300009642	Anaerobic Biogas Reactor	MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE*
Ga0123326_12616912	3300009647	Anaerobic Biogas Reactor	MDSLPRPVTTTDAYLARIVQQNDEIIALMKAEGARPKTRRLKEPKP*
Ga0116179_11815872	3300009657	Anaerobic Digestor Sludge	MDSLPHPVTTTDAYLARIVQQNDEIIALLDQQRATTKPRRLKEPKK*
Ga0116188_10805472	3300009658	Anaerobic Digestor Sludge	MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPAPKQPRRLKEPKE*
Ga0116146_13013982	3300009664	Anaerobic Digestor Sludge	MDDLPRPVTTTDAYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE*
Ga0116182_10287894	3300009666	Anaerobic Digestor Sludge	MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKRPRRLKEPKE*
Ga0116147_11022282	3300009667	Anaerobic Digestor Sludge	MDDLPRPVTTTDAYLARIVQQNDEIIAIMKTWGDRPKT
Ga0116180_12615562	3300009668	Anaerobic Digestor Sludge	MDSLPRPVTTTDAYLARIVEQNDEIIALMKTGGERPKTRRLKEPKP*
Ga0116148_10668963	3300009669	Anaerobic Digestor Sludge	MAHLPPPITTTEIYLARIVQQNDEIIALMKAEGERPKTRRLKEPKP*
Ga0116183_12451072	3300009670	Anaerobic Digestor Sludge	MDNLPHPVTTTEIYLARIMQQNDEIIALLKTEGARPKTRRLKEPKP*
Ga0123334_10717121	3300009671	Anaerobic Biogas Reactor	TTTDAYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP*
Ga0123335_11982642	3300009680	Anaerobic Biogas Reactor	MDDLPHPVTTTDTYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP*
Ga0116172_101353232	3300009682	Anaerobic Digestor Sludge	MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0116172_102582713	3300009682	Anaerobic Digestor Sludge	LPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKRPRRLKEPKE*
Ga0116142_102009732	3300009685	Anaerobic Digestor Sludge	MDTLPHPVTTTDVYLARIVQQNDEIIALMKTEGVRPKPRRLKEPKP*
Ga0116177_104307622	3300009696	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEITALMKTEGVRPKPRRLKEPKP*
Ga0116195_10064187	3300009707	Anaerobic Digestor Sludge	MDSLPHPVTTTDTYLARIVQQNDEIIALLNQQRPEPKQPRRLKEPKE*
Ga0116195_10982461	3300009707	Anaerobic Digestor Sludge	MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRR
Ga0116160_10875093	3300009715	Anaerobic Digestor Sludge	MDDLPHPVTTTDVYLARIVSQNDEIIALMKTEGARPKTRRLKEPKP*
Ga0116161_11572392	3300009767	Anaerobic Digestor Sludge	MDDLPRPVTTTDAYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP*
Ga0116161_14266311	3300009767	Anaerobic Digestor Sludge	MDDLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0116178_100652133	3300009781	Anaerobic Digestor Sludge	MDSLPRPVTTTEIYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0116178_105490472	3300009781	Anaerobic Digestor Sludge	MDTLPHPVTTTDVYLARIVQQNDEIIALMKTEGVRPKPR
Ga0116250_102015274	3300010340	Anaerobic Digestor Sludge	VIIMDNLPHPVTTTEIYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP*
Ga0116250_102136691	3300010340	Anaerobic Digestor Sludge	PSPVTTMDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP*
Ga0116250_102245224	3300010340	Anaerobic Digestor Sludge	MDSLPHPVTTTDTYLARIVQQNDEIIALMKTLGERPKPRRLKEPKP*
Ga0116250_107603232	3300010340	Anaerobic Digestor Sludge	MDVYLARIVEQNDEIIALMKTEGARPKTRRLKEPKP*
Ga0116242_100620226	3300010355	Anaerobic Digestor Sludge	VIIMDDLPHPVTTTEIYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP*
Ga0116249_108758642	3300010357	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP*
Ga0116249_117564062	3300010357	Anaerobic Digestor Sludge	MDTLPHPVTTTEIYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0079063_10106483	3300012881	Anaerobic Digestor Sludge	VIIMDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0172378_102984762	3300014203	Groundwater	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQHRPAPKPRRLKEPKP*
Ga0172378_103361301	3300014203	Groundwater	KPLPVFRVIYMDNLLHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP*
Ga0172378_104902422	3300014203	Groundwater	MDNLPHPVTTTDAYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP*
Ga0172381_105927393	3300014204	Landfill Leachate	MDTLPHPVTTTDVYLARIVQQNDEIIGLLNQQRPAAKPRRLKEPKP*
Ga0172381_113397892	3300014204	Landfill Leachate	MDTLPHPVTTTDVYLARIVDQNDEIIGLLNQQRPAAKPRRLK
Ga0172377_104007442	3300014206	Landfill Leachate	MDSLPHPVTATDAYLARIVEQNDEIIALLNQQRATTKPRRLKEPKK*
Ga0172377_109334672	3300014206	Landfill Leachate	MDSLPRPVTTTDAYLARVVQQNDEIIALMKTEGERPKTRRLKEPKP*
Ga0172377_112361532	3300014206	Landfill Leachate	PRPVTTTDAYLARIVDQNDEIIALMKTRGERPKTRRLKEPKP*
Ga0172382_102642282	3300015214	Landfill Leachate	MDDLPRPVTTTDAYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP*
Ga0172382_103518722	3300015214	Landfill Leachate	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP*
Ga0172382_106595251	3300015214	Landfill Leachate	MVVYLARIVEQNDEIIALMKTLGERPKPRRLKEPKP*
Ga0172382_107822782	3300015214	Landfill Leachate	MDSLPRPVTTTDAYLARIVQQNDEIIALLNQQRPVPKPRRLKEPKP*
Ga0172382_111246901	3300015214	Landfill Leachate	TTDAYLARIVDQNDEIIALMKTRGERPKTRRLKEPKP*
Ga0179957_12233852	3300019222	Anaerobic Digestor Sludge	MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPAPKQPRRLKEPKE
Ga0208462_10114952	3300025408	Anaerobic Digestor Sludge	MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE
Ga0208693_10505202	3300025618	Anaerobic Digestor Sludge	MDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP
Ga0208693_10760622	3300025618	Anaerobic Digestor Sludge	MDNLPHPATTTEIYLARIVQQNDEIIALLDQQRATTKPRRLKEPKK
Ga0208693_11371171	3300025618	Anaerobic Digestor Sludge	PVTTMDVYLARIVQQNDEIIALMKTLGERPKPRRLKEPKP
Ga0208823_10414153	3300025657	Anaerobic Digestor Sludge	MDNLPHPVTTTEIYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP
Ga0208823_10545732	3300025657	Anaerobic Digestor Sludge	MDNLPSPVTTMDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP
Ga0208823_11227062	3300025657	Anaerobic Digestor Sludge	MDDLPHPVTTTEIYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP
Ga0209719_10281046	3300025677	Anaerobic Digestor Sludge	MDDLPHPVTTTDVYLARIVSQNDEIIALMKTEGARPKTRRLKEPKP
Ga0209718_10269522	3300025682	Anaerobic Digestor Sludge	MDDLPHPVTTTDVYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKP
Ga0209201_10332444	3300025708	Anaerobic Digestor Sludge	MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP
Ga0209201_10433131	3300025708	Anaerobic Digestor Sludge	MAHLPPPITTTEIYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP
Ga0209201_11763021	3300025708	Anaerobic Digestor Sludge	MDSLPRPVTTTDAYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP
Ga0208458_11014332	3300025714	Anaerobic Digestor Sludge	MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPAPKPRRLKEPKP
Ga0209096_12310242	3300025859	Anaerobic Digestor Sludge	MDTLPHPVTTTDVYLARIVQQNDEIIALMKTEGVRPKPRRLKEPKP
Ga0209311_10708226	3300025871	Anaerobic Digestor Sludge	LPHPVTTTEIYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP
Ga0209311_12341702	3300025871	Anaerobic Digestor Sludge	MDDLPHPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP
Ga0209509_10739462	3300026194	Anaerobic Biogas Reactor	MDSLPRPVTTTDAYLARIVDQNDEIIALMKAEGERPKTRRLKEPKP
Ga0209312_11251772	3300026195	Anaerobic Biogas Reactor	MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP
Ga0209313_11225032	3300026198	Anaerobic Biogas Reactor	MDDLPHPVTTTDTYLARIVSQNDEIIAPLNQQRPEPKQPRRLKEPKE
Ga0209722_10344293	3300026252	Anaerobic Biogas Reactor	MDNLPHPVTATDAYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP
Ga0209722_11051613	3300026252	Anaerobic Biogas Reactor	MDSLPRPVTTTDAYLARIVQQNDEIIALMKAEGARPKTRRLKEPKP
Ga0209537_100101121	3300027510	Biogas Fermentantion	MDSLPRPVTTTDVYLARIVEQNDEIIALIKTEGARPKTRRLKEPKP
Ga0209537_10199442	3300027510	Biogas Fermentantion	MDSLPSPVTTMDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP
(restricted) Ga0255343_10573882	3300028561	Wastewater	MDNLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE
(restricted) Ga0255345_11840271	3300028568	Wastewater	MDDLPHPVTTTDTYLARIVSQNDEIIALMKTLGERPKPRRLKEPKP
(restricted) Ga0255347_12604181	3300028593	Wastewater	VIYMDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE
(restricted) Ga0255347_13286342	3300028593	Wastewater	MDDLPHPVTTTDAYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP
Ga0265294_101069523	3300028602	Groundwater	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP
Ga0265294_103104441	3300028602	Groundwater	MDSLPHPVTATDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK
Ga0265294_108316602	3300028602	Groundwater	MDSLPHPVTATDAYLARIVQQNDEIIALMKTLGERPKPRRLKEPKP
Ga0265293_107137332	3300028603	Landfill Leachate	MDSLPHPVTATDAYLARIVEQNDEIIALLNQQRATTKPRRLKEPKK
Ga0307354_1032583	3300029667	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPCRLKEPKP
Ga0307355_1184532	3300029673	Anaerobic Digestor Sludge	MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKP
Ga0134854_10100144	3300029822	Fermentation Pit Mud	MDDLPRPVTTTDAYLARIVQQNDEIIGLLNQQRPAAKPRRLKEPKP
Ga0134852_1013694	3300029824	Fermentation Pit Mud	MDSLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters