| Basic Information | |
|---|---|
| Family ID | F071368 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 122 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP |
| Number of Associated Samples | 80 |
| Number of Associated Scaffolds | 122 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 9.02 % |
| % of genes near scaffold ends (potentially truncated) | 18.85 % |
| % of genes from short scaffolds (< 2000 bps) | 84.43 % |
| Associated GOLD sequencing projects | 71 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (42.623 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (45.902 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.443 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (53.279 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.48% β-sheet: 0.00% Coil/Unstructured: 56.52% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 122 Family Scaffolds |
|---|---|---|
| PF10124 | Mu-like_gpT | 24.59 |
| PF05521 | Phage_H_T_join | 14.75 |
| PF11367 | DUF3168 | 3.28 |
| PF04883 | HK97-gp10_like | 2.46 |
| PF01432 | Peptidase_M3 | 0.82 |
| PF09956 | DUF2190 | 0.82 |
| PF02195 | ParBc | 0.82 |
| COG ID | Name | Functional Category | % Frequency in 122 Family Scaffolds |
|---|---|---|---|
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.82 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.82 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 46.72 % |
| Unclassified | root | N/A | 31.15 % |
| Methanogenium | genus | Methanogenium | 22.13 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002163|JGI24707J26582_10130529 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 713 | Open in IMG/M |
| 3300002163|JGI24707J26582_10158027 | Not Available | 618 | Open in IMG/M |
| 3300002163|JGI24707J26582_10196598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 527 | Open in IMG/M |
| 3300002164|JGI24708J26588_10050102 | Not Available | 1555 | Open in IMG/M |
| 3300002164|JGI24708J26588_10095596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 904 | Open in IMG/M |
| 3300002166|JGI24713J26584_10075599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 712 | Open in IMG/M |
| 3300002166|JGI24713J26584_10104147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 548 | Open in IMG/M |
| 3300002168|JGI24712J26585_10220312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora arenicola | 516 | Open in IMG/M |
| 3300002173|JGI24709J26583_10049933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1683 | Open in IMG/M |
| 3300002174|JGI24710J26742_10165617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
| 3300002378|JGI24502J29692_10065845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1082 | Open in IMG/M |
| 3300002406|JGI24499J29688_1014169 | Methanogenium → Methanogenium cariaci | 563 | Open in IMG/M |
| 3300002596|draft_1419371 | Not Available | 8981 | Open in IMG/M |
| 3300002837|bg3kmer60_1105172 | Methanogenium → Methanogenium cariaci | 530 | Open in IMG/M |
| 3300002837|bg3kmer60_1109639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 512 | Open in IMG/M |
| 3300002898|draft_10481623 | Methanogenium → Methanogenium cariaci | 553 | Open in IMG/M |
| 3300003306|Ga0004534J46558_1006136 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300003306|Ga0004534J46558_1008739 | Not Available | 683 | Open in IMG/M |
| 3300003306|Ga0004534J46558_1013679 | Methanogenium → Methanogenium cariaci | 570 | Open in IMG/M |
| 3300003306|Ga0004534J46558_1021939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 569 | Open in IMG/M |
| 3300005835|Ga0078910_102495 | Methanogenium → Methanogenium cariaci | 4032 | Open in IMG/M |
| 3300005835|Ga0078910_106781 | Methanogenium → Methanogenium cariaci | 1178 | Open in IMG/M |
| 3300005835|Ga0078910_119751 | Not Available | 1004 | Open in IMG/M |
| 3300006225|Ga0082206_101995 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 5206 | Open in IMG/M |
| 3300006360|Ga0079079_1192328 | Methanogenium → Methanogenium cariaci | 1622 | Open in IMG/M |
| 3300006376|Ga0079101_1334014 | Not Available | 520 | Open in IMG/M |
| 3300006381|Ga0079102_1387104 | Methanogenium → Methanogenium cariaci | 2097 | Open in IMG/M |
| 3300006386|Ga0079068_1314520 | Not Available | 564 | Open in IMG/M |
| 3300006388|Ga0079062_1429858 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300006395|Ga0079066_1539394 | Not Available | 754 | Open in IMG/M |
| 3300006483|Ga0100240_112171 | All Organisms → cellular organisms → Bacteria | 7065 | Open in IMG/M |
| 3300006594|Ga0079073_1017349 | Not Available | 672 | Open in IMG/M |
| 3300006594|Ga0079073_1018233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1162 | Open in IMG/M |
| 3300006596|Ga0079074_1280935 | All Organisms → cellular organisms → Bacteria → Synergistetes → Synergistia → Synergistales → Synergistaceae → unclassified Synergistaceae → Synergistaceae bacterium | 1490 | Open in IMG/M |
| 3300006600|Ga0079065_1003023 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300006801|Ga0079223_10213362 | Methanogenium → Methanogenium cariaci | 1200 | Open in IMG/M |
| 3300006801|Ga0079223_10536867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 733 | Open in IMG/M |
| 3300006840|Ga0101790_125508 | All Organisms → cellular organisms → Bacteria | 4236 | Open in IMG/M |
| 3300009121|Ga0118671_1027065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1768 | Open in IMG/M |
| 3300009121|Ga0118671_1109227 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300009362|Ga0118673_1131728 | Not Available | 672 | Open in IMG/M |
| 3300009607|Ga0123327_1042947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1916 | Open in IMG/M |
| 3300009642|Ga0123331_1039219 | All Organisms → Viruses → Predicted Viral | 1727 | Open in IMG/M |
| 3300009647|Ga0123326_1261691 | Not Available | 519 | Open in IMG/M |
| 3300009657|Ga0116179_1181587 | Methanogenium → Methanogenium cariaci | 720 | Open in IMG/M |
| 3300009658|Ga0116188_1080547 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300009664|Ga0116146_1301398 | Methanogenium → Methanogenium cariaci | 604 | Open in IMG/M |
| 3300009666|Ga0116182_1028789 | All Organisms → cellular organisms → Bacteria | 3484 | Open in IMG/M |
| 3300009667|Ga0116147_1102228 | All Organisms → Viruses → Predicted Viral | 1222 | Open in IMG/M |
| 3300009668|Ga0116180_1261556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
| 3300009669|Ga0116148_1066896 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300009670|Ga0116183_1245107 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora arenicola | 806 | Open in IMG/M |
| 3300009671|Ga0123334_1071712 | Methanogenium → Methanogenium cariaci | 1850 | Open in IMG/M |
| 3300009680|Ga0123335_1198264 | Not Available | 1038 | Open in IMG/M |
| 3300009682|Ga0116172_10135323 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
| 3300009682|Ga0116172_10258271 | Methanogenium → Methanogenium cariaci | 868 | Open in IMG/M |
| 3300009685|Ga0116142_10200973 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300009696|Ga0116177_10430762 | Not Available | 692 | Open in IMG/M |
| 3300009707|Ga0116195_1006418 | All Organisms → cellular organisms → Bacteria | 4584 | Open in IMG/M |
| 3300009707|Ga0116195_1098246 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300009715|Ga0116160_1087509 | Methanogenium → Methanogenium cariaci | 1372 | Open in IMG/M |
| 3300009767|Ga0116161_1157239 | Methanogenium → Methanogenium cariaci | 1013 | Open in IMG/M |
| 3300009767|Ga0116161_1426631 | Methanogenium → Methanogenium cariaci | 510 | Open in IMG/M |
| 3300009781|Ga0116178_10065213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2023 | Open in IMG/M |
| 3300009781|Ga0116178_10549047 | Not Available | 560 | Open in IMG/M |
| 3300010340|Ga0116250_10201527 | Methanogenium → Methanogenium cariaci | 1221 | Open in IMG/M |
| 3300010340|Ga0116250_10213669 | Methanogenium → Methanogenium cariaci | 1177 | Open in IMG/M |
| 3300010340|Ga0116250_10224522 | Not Available | 1141 | Open in IMG/M |
| 3300010340|Ga0116250_10760323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 525 | Open in IMG/M |
| 3300010355|Ga0116242_10062022 | All Organisms → cellular organisms → Bacteria | 4263 | Open in IMG/M |
| 3300010357|Ga0116249_10875864 | Not Available | 816 | Open in IMG/M |
| 3300010357|Ga0116249_11756406 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012881|Ga0079063_1010648 | All Organisms → cellular organisms → Bacteria | 1908 | Open in IMG/M |
| 3300014203|Ga0172378_10298476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
| 3300014203|Ga0172378_10336130 | Methanogenium → Methanogenium cariaci | 1154 | Open in IMG/M |
| 3300014203|Ga0172378_10490242 | Not Available | 918 | Open in IMG/M |
| 3300014204|Ga0172381_10592739 | Not Available | 848 | Open in IMG/M |
| 3300014204|Ga0172381_11339789 | Not Available | 518 | Open in IMG/M |
| 3300014206|Ga0172377_10400744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1138 | Open in IMG/M |
| 3300014206|Ga0172377_10933467 | Not Available | 673 | Open in IMG/M |
| 3300014206|Ga0172377_11236153 | Not Available | 567 | Open in IMG/M |
| 3300015214|Ga0172382_10264228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1375 | Open in IMG/M |
| 3300015214|Ga0172382_10351872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1132 | Open in IMG/M |
| 3300015214|Ga0172382_10659525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 737 | Open in IMG/M |
| 3300015214|Ga0172382_10782278 | Not Available | 656 | Open in IMG/M |
| 3300015214|Ga0172382_11124690 | Not Available | 513 | Open in IMG/M |
| 3300019222|Ga0179957_1223385 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300025408|Ga0208462_1011495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2277 | Open in IMG/M |
| 3300025618|Ga0208693_1050520 | Methanogenium → Methanogenium cariaci | 1432 | Open in IMG/M |
| 3300025618|Ga0208693_1076062 | Methanogenium → Methanogenium cariaci | 1031 | Open in IMG/M |
| 3300025618|Ga0208693_1137117 | Not Available | 637 | Open in IMG/M |
| 3300025657|Ga0208823_1041415 | All Organisms → cellular organisms → Bacteria | 1817 | Open in IMG/M |
| 3300025657|Ga0208823_1054573 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300025657|Ga0208823_1122706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 761 | Open in IMG/M |
| 3300025677|Ga0209719_1028104 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 2374 | Open in IMG/M |
| 3300025682|Ga0209718_1026952 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 2632 | Open in IMG/M |
| 3300025708|Ga0209201_1033244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2390 | Open in IMG/M |
| 3300025708|Ga0209201_1043313 | All Organisms → cellular organisms → Bacteria | 1962 | Open in IMG/M |
| 3300025708|Ga0209201_1176302 | Not Available | 676 | Open in IMG/M |
| 3300025714|Ga0208458_1101433 | Not Available | 1019 | Open in IMG/M |
| 3300025859|Ga0209096_1231024 | Not Available | 687 | Open in IMG/M |
| 3300025871|Ga0209311_1070822 | Methanogenium → Methanogenium cariaci | 1618 | Open in IMG/M |
| 3300025871|Ga0209311_1234170 | Not Available | 717 | Open in IMG/M |
| 3300026194|Ga0209509_1073946 | Not Available | 833 | Open in IMG/M |
| 3300026195|Ga0209312_1125177 | Methanogenium → Methanogenium cariaci | 630 | Open in IMG/M |
| 3300026198|Ga0209313_1122503 | Not Available | 561 | Open in IMG/M |
| 3300026252|Ga0209722_1034429 | Methanogenium → Methanogenium cariaci | 1887 | Open in IMG/M |
| 3300026252|Ga0209722_1105161 | Not Available | 820 | Open in IMG/M |
| 3300027510|Ga0209537_1001011 | Not Available | 32913 | Open in IMG/M |
| 3300027510|Ga0209537_1019944 | Methanogenium → Methanogenium cariaci | 3153 | Open in IMG/M |
| (restricted) 3300028561|Ga0255343_1057388 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| (restricted) 3300028568|Ga0255345_1184027 | Not Available | 859 | Open in IMG/M |
| (restricted) 3300028593|Ga0255347_1260418 | Not Available | 754 | Open in IMG/M |
| (restricted) 3300028593|Ga0255347_1328634 | Not Available | 626 | Open in IMG/M |
| 3300028602|Ga0265294_10106952 | Methanogenium → Methanogenium cariaci | 2223 | Open in IMG/M |
| 3300028602|Ga0265294_10310444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1045 | Open in IMG/M |
| 3300028602|Ga0265294_10831660 | Not Available | 509 | Open in IMG/M |
| 3300028603|Ga0265293_10713733 | Methanogenium → Methanogenium cariaci | 535 | Open in IMG/M |
| 3300029667|Ga0307354_103258 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
| 3300029673|Ga0307355_118453 | Not Available | 784 | Open in IMG/M |
| 3300029822|Ga0134854_1010014 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium ADurb.BinA028 | 3908 | Open in IMG/M |
| 3300029824|Ga0134852_101369 | Not Available | 1408 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 45.90% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 14.75% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 9.02% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 8.20% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 4.92% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 3.28% |
| Anaerobic Wastewater Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge | 2.46% |
| Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor | 2.46% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 1.64% |
| Fermentation Pit Mud | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud | 1.64% |
| Biogas Reactor | Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor | 1.64% |
| Manure | Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure | 0.82% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.82% |
| Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 0.82% |
| Anaerobic Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Anaerobic Reactor | 0.82% |
| Mixed Substrate Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor | 0.82% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002163 | Biogas fermentation microbial communities from Germany - Plant 1 DNA1 | Engineered | Open in IMG/M |
| 3300002164 | Biogas fermentation microbial communities from Germany - Plant 1 DNA2 | Engineered | Open in IMG/M |
| 3300002166 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 | Engineered | Open in IMG/M |
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002173 | Biogas fermentation microbial communities from Germany - Plant 2 DNA1 | Engineered | Open in IMG/M |
| 3300002174 | Biogas fermentation microbial communities from Germany - Plant 2 DNA2 | Engineered | Open in IMG/M |
| 3300002378 | Biogas fermentation microbial communities from Germany - Plant 3 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002406 | Biogas fermentation microbial communities from Germany - Plant 1 RNA2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300002596 | Hydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10 | Engineered | Open in IMG/M |
| 3300002837 | Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer | Engineered | Open in IMG/M |
| 3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
| 3300003306 | Biogas fermentation microbial communities from Germany - Plant 1 RNA1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300005835 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads | Engineered | Open in IMG/M |
| 3300006225 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy | Engineered | Open in IMG/M |
| 3300006360 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Val_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006376 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1013_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006381 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Total_1113_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006386 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Oil_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006388 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006395 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006483 | Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture C4 | Engineered | Open in IMG/M |
| 3300006594 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006596 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Leu_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006600 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_01_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006801 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 | Environmental | Open in IMG/M |
| 3300006840 | Anaerobic bioreactor microbial communities from Canach, Luxembourg | Engineered | Open in IMG/M |
| 3300009121 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C12.But.A IDBA | Engineered | Open in IMG/M |
| 3300009362 | Syntrophic microbial communities from biogas reactors - R1.C13.But.A IBDA | Engineered | Open in IMG/M |
| 3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009642 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG | Engineered | Open in IMG/M |
| 3300009658 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG | Engineered | Open in IMG/M |
| 3300009664 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009667 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG | Engineered | Open in IMG/M |
| 3300009668 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009680 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009696 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC10_MetaG | Engineered | Open in IMG/M |
| 3300009707 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009781 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC12_MetaG | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010355 | AD_USDVca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300012881 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_02_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300019222 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNTR4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300025408 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU001_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025618 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025714 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC085_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025859 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025871 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC045_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026194 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026195 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026198 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026252 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C12 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027510 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes) | Engineered | Open in IMG/M |
| 3300028561 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant16 | Engineered | Open in IMG/M |
| 3300028568 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant20 | Engineered | Open in IMG/M |
| 3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300029667 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Trp1 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029673 | Metatranscriptome of enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAT_UR_Trp2 (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300029822 | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T | Engineered | Open in IMG/M |
| 3300029824 | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-1-30-B | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24707J26582_101305291 | 3300002163 | Biogas Fermentantion | MDRLPHPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK* |
| JGI24707J26582_101580272 | 3300002163 | Biogas Fermentantion | MDSLPSPVTTTDVYLARIVEQNDEIIALLKTGGERPKTRRLKEPKP* |
| JGI24707J26582_101965981 | 3300002163 | Biogas Fermentantion | MDDLPRPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLK |
| JGI24708J26588_100501022 | 3300002164 | Biogas Fermentantion | MDDLPRPVTTTDAYLARIVEQNDEIIALMKTGGGRPKTRRLKEPKP* |
| JGI24708J26588_100955962 | 3300002164 | Biogas Fermentantion | MDSLPSPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP* |
| JGI24713J26584_100755992 | 3300002166 | Biogas Fermentantion | MDSLPSPVTTMDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP* |
| JGI24713J26584_101041472 | 3300002166 | Biogas Fermentantion | MDSLPRPVTTTDVYLARIVEQNDEIIALIKTEGARPKTRRLKEPKP* |
| JGI24712J26585_102203122 | 3300002168 | Biogas Fermentantion | MDNLPRPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK* |
| JGI24709J26583_100499332 | 3300002173 | Biogas Fermentantion | MDNLPHPVTTTEIYLARIVQQNDEIIALMKTGGARPKTRRLKEPKP* |
| JGI24710J26742_101656172 | 3300002174 | Biogas Fermentantion | MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP* |
| JGI24502J29692_100658452 | 3300002378 | Biogas Fermentantion | MDNLPRPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP* |
| JGI24499J29688_10141691 | 3300002406 | Biogas Fermentantion | MDSLPSPVTTTDVYLARIVEQNDEIIALLNQQRATTKPRRLKEPKK* |
| draft_141937111 | 3300002596 | Hydrocarbon Resource Environments | MDSLPHPVTATDAYLARIVQQNDEIIALMKTLGERPKTRRLKEPKP* |
| bg3kmer60_11051722 | 3300002837 | Biogas Reactor | VITMDNLPHPVTTTEIYLARIVQQNDEIIGLLNQQRPAAKPRRLKEPKP* |
| bg3kmer60_11096391 | 3300002837 | Biogas Reactor | MVSLPRPVTTTDAYLARIVEQNDEIIALMKTGGERPKTRRLKEPKP* |
| draft_104816231 | 3300002898 | Biogas Fermenter | MDSLPHPVTATDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK* |
| Ga0004534J46558_10061362 | 3300003306 | Biogas Fermentantion | MDRLPHPVTTTDAYLARIVEQNDEIIALMKTGGERPKTRRLKEPKP* |
| Ga0004534J46558_10087391 | 3300003306 | Biogas Fermentantion | MDSLPSPVTTTDVYLARIVEQNDEIIALMKTGGERPKTRRLKEPKP* |
| Ga0004534J46558_10136791 | 3300003306 | Biogas Fermentantion | MDSLPHPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK* |
| Ga0004534J46558_10219392 | 3300003306 | Biogas Fermentantion | MDSLPSPVTTTDVYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK* |
| Ga0078910_1024952 | 3300005835 | Biogas Reactor | MDRLPHPVTATDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK* |
| Ga0078910_1067813 | 3300005835 | Biogas Reactor | MDNLPHPVTATDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK* |
| Ga0078910_1197512 | 3300005835 | Biogas Reactor | MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGGRPKTRRLKEPKP* |
| Ga0082206_1019952 | 3300006225 | Mixed Substrate Biogas Reactor | MDSLPRPVTTTDAYLARIVEQNDEIIALMKTWGERPKTRRLKEPKP* |
| Ga0079079_11923284 | 3300006360 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0079101_13340142 | 3300006376 | Anaerobic Digestor Sludge | VIYMDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0079102_13871044 | 3300006381 | Anaerobic Digestor Sludge | MDDLPHPVTTTEIYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP* |
| Ga0079068_13145202 | 3300006386 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPR |
| Ga0079062_14298582 | 3300006388 | Anaerobic Digestor Sludge | MDDLPRPVTTTEIYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0079066_15393942 | 3300006395 | Anaerobic Digestor Sludge | MDNLPHPVTTTEIYLARIVQQNDEIIALLNQQRPAPKPR |
| Ga0100240_1121715 | 3300006483 | Manure | MDSLPRPVTTTDAYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP* |
| Ga0079073_10173492 | 3300006594 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRR |
| Ga0079073_10182332 | 3300006594 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRL |
| Ga0079074_12809354 | 3300006596 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEIIALMKTEGVRPKPRRLKEPKP* |
| Ga0079065_10030231 | 3300006600 | Anaerobic Digestor Sludge | MDDLPHPVTTTEIYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP |
| Ga0079223_102133624 | 3300006801 | Agricultural Soil | MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGVRPKTRRLKEPKP* |
| Ga0079223_105368671 | 3300006801 | Agricultural Soil | MDSLPSPVTTMDVYLARIVEQNDEIIALLNQQRATTKPRRLKEPKK* |
| Ga0101790_1255083 | 3300006840 | Anaerobic Reactor | MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP* |
| Ga0118671_10270656 | 3300009121 | Anaerobic Wastewater Sludge | VIIMDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP* |
| Ga0118671_11092272 | 3300009121 | Anaerobic Wastewater Sludge | MDSLPRPVTTTDAYLARIVDQNDEIIALMKAEGERPKTRRLKEPKP* |
| Ga0118673_11317281 | 3300009362 | Anaerobic Wastewater Sludge | IYMDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE* |
| Ga0123327_10429473 | 3300009607 | Anaerobic Biogas Reactor | MDDLPHPVTTTDTYLARIVSQNDEIIAPLNQQRPEPKQPRRLKEPKE* |
| Ga0123331_10392194 | 3300009642 | Anaerobic Biogas Reactor | MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE* |
| Ga0123326_12616912 | 3300009647 | Anaerobic Biogas Reactor | MDSLPRPVTTTDAYLARIVQQNDEIIALMKAEGARPKTRRLKEPKP* |
| Ga0116179_11815872 | 3300009657 | Anaerobic Digestor Sludge | MDSLPHPVTTTDAYLARIVQQNDEIIALLDQQRATTKPRRLKEPKK* |
| Ga0116188_10805472 | 3300009658 | Anaerobic Digestor Sludge | MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPAPKQPRRLKEPKE* |
| Ga0116146_13013982 | 3300009664 | Anaerobic Digestor Sludge | MDDLPRPVTTTDAYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE* |
| Ga0116182_10287894 | 3300009666 | Anaerobic Digestor Sludge | MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKRPRRLKEPKE* |
| Ga0116147_11022282 | 3300009667 | Anaerobic Digestor Sludge | MDDLPRPVTTTDAYLARIVQQNDEIIAIMKTWGDRPKT |
| Ga0116180_12615562 | 3300009668 | Anaerobic Digestor Sludge | MDSLPRPVTTTDAYLARIVEQNDEIIALMKTGGERPKTRRLKEPKP* |
| Ga0116148_10668963 | 3300009669 | Anaerobic Digestor Sludge | MAHLPPPITTTEIYLARIVQQNDEIIALMKAEGERPKTRRLKEPKP* |
| Ga0116183_12451072 | 3300009670 | Anaerobic Digestor Sludge | MDNLPHPVTTTEIYLARIMQQNDEIIALLKTEGARPKTRRLKEPKP* |
| Ga0123334_10717121 | 3300009671 | Anaerobic Biogas Reactor | TTTDAYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP* |
| Ga0123335_11982642 | 3300009680 | Anaerobic Biogas Reactor | MDDLPHPVTTTDTYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP* |
| Ga0116172_101353232 | 3300009682 | Anaerobic Digestor Sludge | MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0116172_102582713 | 3300009682 | Anaerobic Digestor Sludge | LPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKRPRRLKEPKE* |
| Ga0116142_102009732 | 3300009685 | Anaerobic Digestor Sludge | MDTLPHPVTTTDVYLARIVQQNDEIIALMKTEGVRPKPRRLKEPKP* |
| Ga0116177_104307622 | 3300009696 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEITALMKTEGVRPKPRRLKEPKP* |
| Ga0116195_10064187 | 3300009707 | Anaerobic Digestor Sludge | MDSLPHPVTTTDTYLARIVQQNDEIIALLNQQRPEPKQPRRLKEPKE* |
| Ga0116195_10982461 | 3300009707 | Anaerobic Digestor Sludge | MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRR |
| Ga0116160_10875093 | 3300009715 | Anaerobic Digestor Sludge | MDDLPHPVTTTDVYLARIVSQNDEIIALMKTEGARPKTRRLKEPKP* |
| Ga0116161_11572392 | 3300009767 | Anaerobic Digestor Sludge | MDDLPRPVTTTDAYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP* |
| Ga0116161_14266311 | 3300009767 | Anaerobic Digestor Sludge | MDDLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0116178_100652133 | 3300009781 | Anaerobic Digestor Sludge | MDSLPRPVTTTEIYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0116178_105490472 | 3300009781 | Anaerobic Digestor Sludge | MDTLPHPVTTTDVYLARIVQQNDEIIALMKTEGVRPKPR |
| Ga0116250_102015274 | 3300010340 | Anaerobic Digestor Sludge | VIIMDNLPHPVTTTEIYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP* |
| Ga0116250_102136691 | 3300010340 | Anaerobic Digestor Sludge | PSPVTTMDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP* |
| Ga0116250_102245224 | 3300010340 | Anaerobic Digestor Sludge | MDSLPHPVTTTDTYLARIVQQNDEIIALMKTLGERPKPRRLKEPKP* |
| Ga0116250_107603232 | 3300010340 | Anaerobic Digestor Sludge | MDVYLARIVEQNDEIIALMKTEGARPKTRRLKEPKP* |
| Ga0116242_100620226 | 3300010355 | Anaerobic Digestor Sludge | VIIMDDLPHPVTTTEIYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP* |
| Ga0116249_108758642 | 3300010357 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP* |
| Ga0116249_117564062 | 3300010357 | Anaerobic Digestor Sludge | MDTLPHPVTTTEIYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0079063_10106483 | 3300012881 | Anaerobic Digestor Sludge | VIIMDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0172378_102984762 | 3300014203 | Groundwater | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQHRPAPKPRRLKEPKP* |
| Ga0172378_103361301 | 3300014203 | Groundwater | KPLPVFRVIYMDNLLHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP* |
| Ga0172378_104902422 | 3300014203 | Groundwater | MDNLPHPVTTTDAYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP* |
| Ga0172381_105927393 | 3300014204 | Landfill Leachate | MDTLPHPVTTTDVYLARIVQQNDEIIGLLNQQRPAAKPRRLKEPKP* |
| Ga0172381_113397892 | 3300014204 | Landfill Leachate | MDTLPHPVTTTDVYLARIVDQNDEIIGLLNQQRPAAKPRRLK |
| Ga0172377_104007442 | 3300014206 | Landfill Leachate | MDSLPHPVTATDAYLARIVEQNDEIIALLNQQRATTKPRRLKEPKK* |
| Ga0172377_109334672 | 3300014206 | Landfill Leachate | MDSLPRPVTTTDAYLARVVQQNDEIIALMKTEGERPKTRRLKEPKP* |
| Ga0172377_112361532 | 3300014206 | Landfill Leachate | PRPVTTTDAYLARIVDQNDEIIALMKTRGERPKTRRLKEPKP* |
| Ga0172382_102642282 | 3300015214 | Landfill Leachate | MDDLPRPVTTTDAYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP* |
| Ga0172382_103518722 | 3300015214 | Landfill Leachate | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP* |
| Ga0172382_106595251 | 3300015214 | Landfill Leachate | MVVYLARIVEQNDEIIALMKTLGERPKPRRLKEPKP* |
| Ga0172382_107822782 | 3300015214 | Landfill Leachate | MDSLPRPVTTTDAYLARIVQQNDEIIALLNQQRPVPKPRRLKEPKP* |
| Ga0172382_111246901 | 3300015214 | Landfill Leachate | TTDAYLARIVDQNDEIIALMKTRGERPKTRRLKEPKP* |
| Ga0179957_12233852 | 3300019222 | Anaerobic Digestor Sludge | MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPAPKQPRRLKEPKE |
| Ga0208462_10114952 | 3300025408 | Anaerobic Digestor Sludge | MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE |
| Ga0208693_10505202 | 3300025618 | Anaerobic Digestor Sludge | MDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP |
| Ga0208693_10760622 | 3300025618 | Anaerobic Digestor Sludge | MDNLPHPATTTEIYLARIVQQNDEIIALLDQQRATTKPRRLKEPKK |
| Ga0208693_11371171 | 3300025618 | Anaerobic Digestor Sludge | PVTTMDVYLARIVQQNDEIIALMKTLGERPKPRRLKEPKP |
| Ga0208823_10414153 | 3300025657 | Anaerobic Digestor Sludge | MDNLPHPVTTTEIYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP |
| Ga0208823_10545732 | 3300025657 | Anaerobic Digestor Sludge | MDNLPSPVTTMDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP |
| Ga0208823_11227062 | 3300025657 | Anaerobic Digestor Sludge | MDDLPHPVTTTEIYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP |
| Ga0209719_10281046 | 3300025677 | Anaerobic Digestor Sludge | MDDLPHPVTTTDVYLARIVSQNDEIIALMKTEGARPKTRRLKEPKP |
| Ga0209718_10269522 | 3300025682 | Anaerobic Digestor Sludge | MDDLPHPVTTTDVYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKP |
| Ga0209201_10332444 | 3300025708 | Anaerobic Digestor Sludge | MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP |
| Ga0209201_10433131 | 3300025708 | Anaerobic Digestor Sludge | MAHLPPPITTTEIYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP |
| Ga0209201_11763021 | 3300025708 | Anaerobic Digestor Sludge | MDSLPRPVTTTDAYLARIVQQNDEIIALMKTEGERPKTRRLKEPKP |
| Ga0208458_11014332 | 3300025714 | Anaerobic Digestor Sludge | MDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPAPKPRRLKEPKP |
| Ga0209096_12310242 | 3300025859 | Anaerobic Digestor Sludge | MDTLPHPVTTTDVYLARIVQQNDEIIALMKTEGVRPKPRRLKEPKP |
| Ga0209311_10708226 | 3300025871 | Anaerobic Digestor Sludge | LPHPVTTTEIYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP |
| Ga0209311_12341702 | 3300025871 | Anaerobic Digestor Sludge | MDDLPHPVTTTDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKP |
| Ga0209509_10739462 | 3300026194 | Anaerobic Biogas Reactor | MDSLPRPVTTTDAYLARIVDQNDEIIALMKAEGERPKTRRLKEPKP |
| Ga0209312_11251772 | 3300026195 | Anaerobic Biogas Reactor | MDNLPHPVTTTEIYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP |
| Ga0209313_11225032 | 3300026198 | Anaerobic Biogas Reactor | MDDLPHPVTTTDTYLARIVSQNDEIIAPLNQQRPEPKQPRRLKEPKE |
| Ga0209722_10344293 | 3300026252 | Anaerobic Biogas Reactor | MDNLPHPVTATDAYLARIVQQNDEIIALMKTEGARPKTRRLKEPKP |
| Ga0209722_11051613 | 3300026252 | Anaerobic Biogas Reactor | MDSLPRPVTTTDAYLARIVQQNDEIIALMKAEGARPKTRRLKEPKP |
| Ga0209537_100101121 | 3300027510 | Biogas Fermentantion | MDSLPRPVTTTDVYLARIVEQNDEIIALIKTEGARPKTRRLKEPKP |
| Ga0209537_10199442 | 3300027510 | Biogas Fermentantion | MDSLPSPVTTMDVYLARIVEQNDEIIALMKTWGDRPKTRRLKEPKP |
| (restricted) Ga0255343_10573882 | 3300028561 | Wastewater | MDNLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE |
| (restricted) Ga0255345_11840271 | 3300028568 | Wastewater | MDDLPHPVTTTDTYLARIVSQNDEIIALMKTLGERPKPRRLKEPKP |
| (restricted) Ga0255347_12604181 | 3300028593 | Wastewater | VIYMDDLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE |
| (restricted) Ga0255347_13286342 | 3300028593 | Wastewater | MDDLPHPVTTTDAYLARIVQQNDEIIALMKTGGERPKTRRLKEPKP |
| Ga0265294_101069523 | 3300028602 | Groundwater | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPRRLKEPKP |
| Ga0265294_103104441 | 3300028602 | Groundwater | MDSLPHPVTATDAYLARIVQQNDEIIALLNQQRATTKPRRLKEPKK |
| Ga0265294_108316602 | 3300028602 | Groundwater | MDSLPHPVTATDAYLARIVQQNDEIIALMKTLGERPKPRRLKEPKP |
| Ga0265293_107137332 | 3300028603 | Landfill Leachate | MDSLPHPVTATDAYLARIVEQNDEIIALLNQQRATTKPRRLKEPKK |
| Ga0307354_1032583 | 3300029667 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKPCRLKEPKP |
| Ga0307355_1184532 | 3300029673 | Anaerobic Digestor Sludge | MDNLPHPVTTTDVYLARIVQQNDEIIALLNQQRPAPKP |
| Ga0134854_10100144 | 3300029822 | Fermentation Pit Mud | MDDLPRPVTTTDAYLARIVQQNDEIIGLLNQQRPAAKPRRLKEPKP |
| Ga0134852_1013694 | 3300029824 | Fermentation Pit Mud | MDSLPHPVTTTDTYLARIVSQNDEIIALLNQQRPEPKQPRRLKEPKE |
| ⦗Top⦘ |