| Basic Information | |
|---|---|
| Family ID | F063807 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MKPPRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Number of Associated Samples | 81 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 53.49 % |
| % of genes near scaffold ends (potentially truncated) | 37.98 % |
| % of genes from short scaffolds (< 2000 bps) | 85.27 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (41.085 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (43.411 % of family members) |
| Environment Ontology (ENVO) | Unclassified (93.023 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (48.837 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 77.08% β-sheet: 0.00% Coil/Unstructured: 22.92% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF02195 | ParBc | 20.16 |
| PF03237 | Terminase_6N | 9.30 |
| PF08706 | D5_N | 1.55 |
| PF01555 | N6_N4_Mtase | 1.55 |
| PF03288 | Pox_D5 | 0.78 |
| PF13384 | HTH_23 | 0.78 |
| PF09250 | Prim-Pol | 0.78 |
| PF13518 | HTH_28 | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 1.55 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 1.55 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 1.55 |
| COG3378 | DNA primase, phage- or plasmid-associated | Mobilome: prophages, transposons [X] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.24 % |
| Unclassified | root | N/A | 38.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001592|Draft_10016570 | All Organisms → cellular organisms → Bacteria | 6002 | Open in IMG/M |
| 3300002163|JGI24707J26582_10084750 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1000 | Open in IMG/M |
| 3300002163|JGI24707J26582_10171278 | Not Available | 582 | Open in IMG/M |
| 3300002164|JGI24708J26588_10142100 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 662 | Open in IMG/M |
| 3300002166|JGI24713J26584_10029133 | Not Available | 1665 | Open in IMG/M |
| 3300002166|JGI24713J26584_10048085 | Not Available | 1051 | Open in IMG/M |
| 3300002166|JGI24713J26584_10104276 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 548 | Open in IMG/M |
| 3300002167|JGI24714J26587_10031113 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1715 | Open in IMG/M |
| 3300002167|JGI24714J26587_10056476 | Not Available | 974 | Open in IMG/M |
| 3300002168|JGI24712J26585_10131346 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 778 | Open in IMG/M |
| 3300002168|JGI24712J26585_10196313 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 564 | Open in IMG/M |
| 3300002173|JGI24709J26583_10056551 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1516 | Open in IMG/M |
| 3300002173|JGI24709J26583_10124541 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 783 | Open in IMG/M |
| 3300002173|JGI24709J26583_10205422 | Not Available | 529 | Open in IMG/M |
| 3300002174|JGI24710J26742_10091756 | Not Available | 1093 | Open in IMG/M |
| 3300002596|draft_1418397 | All Organisms → cellular organisms → Bacteria | 6905 | Open in IMG/M |
| 3300002837|bg3kmer60_1075585 | Not Available | 690 | Open in IMG/M |
| 3300002898|draft_10482580 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 552 | Open in IMG/M |
| 3300003667|LSCM3L_1039247 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 711 | Open in IMG/M |
| 3300005835|Ga0078910_102469 | All Organisms → cellular organisms → Bacteria | 25492 | Open in IMG/M |
| 3300006225|Ga0082206_102053 | Not Available | 9302 | Open in IMG/M |
| 3300006398|Ga0079067_1026190 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 862 | Open in IMG/M |
| 3300006483|Ga0100240_112169 | All Organisms → cellular organisms → Bacteria | 4816 | Open in IMG/M |
| 3300006801|Ga0079223_10267596 | Not Available | 1059 | Open in IMG/M |
| 3300009122|Ga0118674_1086402 | Not Available | 706 | Open in IMG/M |
| 3300009607|Ga0123327_1189199 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 676 | Open in IMG/M |
| 3300009607|Ga0123327_1214863 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 623 | Open in IMG/M |
| 3300009642|Ga0123331_1261721 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 512 | Open in IMG/M |
| 3300009647|Ga0123326_1032977 | Not Available | 2067 | Open in IMG/M |
| 3300009652|Ga0123330_1030348 | Not Available | 2609 | Open in IMG/M |
| 3300009652|Ga0123330_1089171 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1216 | Open in IMG/M |
| 3300009655|Ga0116190_1213670 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 652 | Open in IMG/M |
| 3300009656|Ga0123329_1130963 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 952 | Open in IMG/M |
| 3300009656|Ga0123329_1281186 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 581 | Open in IMG/M |
| 3300009657|Ga0116179_1163021 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 773 | Open in IMG/M |
| 3300009657|Ga0116179_1211808 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 651 | Open in IMG/M |
| 3300009657|Ga0116179_1219617 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 635 | Open in IMG/M |
| 3300009657|Ga0116179_1268394 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 559 | Open in IMG/M |
| 3300009663|Ga0116181_1227222 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 688 | Open in IMG/M |
| 3300009666|Ga0116182_1150345 | Not Available | 1092 | Open in IMG/M |
| 3300009668|Ga0116180_1051453 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 1975 | Open in IMG/M |
| 3300009669|Ga0116148_1042447 | Not Available | 2622 | Open in IMG/M |
| 3300009670|Ga0116183_1102614 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1507 | Open in IMG/M |
| 3300009670|Ga0116183_1304210 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 692 | Open in IMG/M |
| 3300009671|Ga0123334_1071237 | Not Available | 1858 | Open in IMG/M |
| 3300009675|Ga0116149_1122537 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1302 | Open in IMG/M |
| 3300009675|Ga0116149_1204150 | Not Available | 904 | Open in IMG/M |
| 3300009682|Ga0116172_10176911 | Not Available | 1121 | Open in IMG/M |
| 3300009685|Ga0116142_10124498 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1375 | Open in IMG/M |
| 3300009687|Ga0116144_10183273 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1127 | Open in IMG/M |
| 3300009688|Ga0116176_10212075 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 977 | Open in IMG/M |
| 3300009690|Ga0116143_10392283 | Not Available | 700 | Open in IMG/M |
| 3300009693|Ga0116141_10191012 | Not Available | 1138 | Open in IMG/M |
| 3300009707|Ga0116195_1007945 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | 3931 | Open in IMG/M |
| 3300009715|Ga0116160_1078480 | Not Available | 1480 | Open in IMG/M |
| 3300009715|Ga0116160_1310992 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 585 | Open in IMG/M |
| 3300009767|Ga0116161_1100945 | Not Available | 1377 | Open in IMG/M |
| 3300009770|Ga0123332_1230831 | Not Available | 769 | Open in IMG/M |
| 3300009773|Ga0123333_10090070 | Not Available | 1524 | Open in IMG/M |
| 3300009773|Ga0123333_10228003 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300009773|Ga0123333_10279025 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 702 | Open in IMG/M |
| 3300010340|Ga0116250_10231300 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 1120 | Open in IMG/M |
| 3300010340|Ga0116250_10382263 | Not Available | 818 | Open in IMG/M |
| 3300010340|Ga0116250_10386102 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 813 | Open in IMG/M |
| 3300010340|Ga0116250_10502246 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 687 | Open in IMG/M |
| 3300010344|Ga0116243_10536305 | Not Available | 708 | Open in IMG/M |
| 3300010353|Ga0116236_10194563 | Not Available | 1844 | Open in IMG/M |
| 3300010356|Ga0116237_11300654 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 601 | Open in IMG/M |
| 3300010357|Ga0116249_11279600 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 657 | Open in IMG/M |
| 3300014203|Ga0172378_10079012 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 2752 | Open in IMG/M |
| 3300014203|Ga0172378_10101404 | Not Available | 2375 | Open in IMG/M |
| 3300014204|Ga0172381_11197461 | Not Available | 554 | Open in IMG/M |
| 3300014204|Ga0172381_11420299 | Not Available | 500 | Open in IMG/M |
| 3300014205|Ga0172380_10144246 | Not Available | 1897 | Open in IMG/M |
| 3300014206|Ga0172377_10204283 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon ADurb.Bin009 | 1722 | Open in IMG/M |
| 3300014206|Ga0172377_10470028 | Not Available | 1030 | Open in IMG/M |
| 3300014206|Ga0172377_10490916 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1003 | Open in IMG/M |
| 3300014206|Ga0172377_10547908 | Not Available | 937 | Open in IMG/M |
| 3300014206|Ga0172377_11018021 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 638 | Open in IMG/M |
| 3300014206|Ga0172377_11367850 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 533 | Open in IMG/M |
| 3300014206|Ga0172377_11493909 | Not Available | 506 | Open in IMG/M |
| 3300015214|Ga0172382_10643299 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 749 | Open in IMG/M |
| 3300015214|Ga0172382_10717629 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 695 | Open in IMG/M |
| 3300015214|Ga0172382_10872884 | Not Available | 609 | Open in IMG/M |
| 3300025408|Ga0208462_1037836 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 888 | Open in IMG/M |
| 3300025618|Ga0208693_1038943 | Not Available | 1756 | Open in IMG/M |
| 3300025618|Ga0208693_1088273 | Not Available | 913 | Open in IMG/M |
| 3300025618|Ga0208693_1141233 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 622 | Open in IMG/M |
| 3300025618|Ga0208693_1142799 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 616 | Open in IMG/M |
| 3300025618|Ga0208693_1181745 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 505 | Open in IMG/M |
| 3300025638|Ga0208198_1029789 | Not Available | 2200 | Open in IMG/M |
| 3300025657|Ga0208823_1022901 | All Organisms → cellular organisms → Bacteria | 2858 | Open in IMG/M |
| 3300025657|Ga0208823_1080479 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 1068 | Open in IMG/M |
| 3300025657|Ga0208823_1138433 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales | 691 | Open in IMG/M |
| 3300025657|Ga0208823_1160607 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 614 | Open in IMG/M |
| 3300025677|Ga0209719_1021048 | Not Available | 3010 | Open in IMG/M |
| 3300025677|Ga0209719_1168588 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 592 | Open in IMG/M |
| 3300025682|Ga0209718_1115403 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 838 | Open in IMG/M |
| 3300025683|Ga0208564_1017888 | All Organisms → cellular organisms → Bacteria | 3424 | Open in IMG/M |
| 3300025683|Ga0208564_1070028 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanotrichales → Methanotrichaceae → Methanothrix → unclassified Methanothrix → Methanosaeta sp. PtaU1.Bin060 | 1238 | Open in IMG/M |
| 3300025683|Ga0208564_1107805 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 892 | Open in IMG/M |
| 3300025683|Ga0208564_1155755 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 668 | Open in IMG/M |
| 3300025708|Ga0209201_1048101 | Not Available | 1817 | Open in IMG/M |
| 3300025713|Ga0208195_1195702 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 627 | Open in IMG/M |
| 3300025730|Ga0209606_1253185 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 535 | Open in IMG/M |
| 3300025737|Ga0208694_1239461 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 559 | Open in IMG/M |
| 3300025748|Ga0208459_1174021 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 752 | Open in IMG/M |
| 3300025784|Ga0209200_1137360 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 889 | Open in IMG/M |
| 3300026194|Ga0209509_1144794 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 515 | Open in IMG/M |
| 3300026195|Ga0209312_1112043 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 684 | Open in IMG/M |
| 3300026250|Ga0209612_1123568 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 694 | Open in IMG/M |
| 3300026255|Ga0209613_1028463 | Not Available | 1922 | Open in IMG/M |
| 3300026311|Ga0209723_1115084 | Not Available | 1094 | Open in IMG/M |
| 3300027510|Ga0209537_1001011 | Not Available | 32913 | Open in IMG/M |
| 3300027510|Ga0209537_1014772 | All Organisms → cellular organisms → Bacteria | 4159 | Open in IMG/M |
| 3300027510|Ga0209537_1065065 | Not Available | 1013 | Open in IMG/M |
| 3300027711|Ga0209075_1267850 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 669 | Open in IMG/M |
| (restricted) 3300028570|Ga0255341_1257583 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 666 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1145399 | Not Available | 1048 | Open in IMG/M |
| (restricted) 3300028576|Ga0255340_1188194 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 865 | Open in IMG/M |
| 3300028602|Ga0265294_10383291 | Not Available | 896 | Open in IMG/M |
| 3300028602|Ga0265294_10568550 | Not Available | 673 | Open in IMG/M |
| 3300028602|Ga0265294_10606069 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → unclassified Methanomicrobiales → Methanomicrobiales archaeon | 643 | Open in IMG/M |
| 3300028602|Ga0265294_10781064 | Not Available | 533 | Open in IMG/M |
| 3300028603|Ga0265293_10313446 | Not Available | 991 | Open in IMG/M |
| 3300028633|Ga0302236_1118302 | All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166 | 535 | Open in IMG/M |
| 3300029775|Ga0134843_1003948 | Not Available | 7508 | Open in IMG/M |
| 3300029822|Ga0134854_1011991 | Not Available | 3326 | Open in IMG/M |
| 3300029824|Ga0134852_101407 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 43.41% |
| Anaerobic Biogas Reactor | Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor | 13.95% |
| Biogas Fermentantion | Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion | 13.18% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 10.85% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 4.65% |
| Fermentation Pit Mud | Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Fermentation Pit Mud | 2.33% |
| Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 2.33% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Agricultural Soil | 1.55% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 1.55% |
| Coalbed Water | Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water | 0.78% |
| Manure | Engineered → Solid Waste → Animal Waste → Unclassified → Unclassified → Manure | 0.78% |
| Activated Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Activated Sludge | 0.78% |
| Anaerobic Wastewater Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Wastewater Sludge | 0.78% |
| Biogas Fermenter | Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter | 0.78% |
| Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Biogas Reactor | 0.78% |
| Mixed Substrate Biogas Reactor | Engineered → Bioreactor → Continuous Culture → Marine Sediment Inoculum → Unclassified → Mixed Substrate Biogas Reactor | 0.78% |
| Biogas Reactor | Engineered → Biotransformation → Unclassified → Unclassified → Unclassified → Biogas Reactor | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001592 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April2: | Engineered | Open in IMG/M |
| 3300002163 | Biogas fermentation microbial communities from Germany - Plant 1 DNA1 | Engineered | Open in IMG/M |
| 3300002164 | Biogas fermentation microbial communities from Germany - Plant 1 DNA2 | Engineered | Open in IMG/M |
| 3300002166 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 | Engineered | Open in IMG/M |
| 3300002167 | Biogas fermentation microbial communities from Germany - Plant 4 DNA2 | Engineered | Open in IMG/M |
| 3300002168 | Biogas fermentation microbial communities from Germany - Plant 3 DNA2 | Engineered | Open in IMG/M |
| 3300002173 | Biogas fermentation microbial communities from Germany - Plant 2 DNA1 | Engineered | Open in IMG/M |
| 3300002174 | Biogas fermentation microbial communities from Germany - Plant 2 DNA2 | Engineered | Open in IMG/M |
| 3300002596 | Hydrocarbon contaminated oil fields microbial communities from Alberta, Canada - Microbes in water sample from Medicine Hat oil field -PW_MHGC_2012April10 | Engineered | Open in IMG/M |
| 3300002837 | Biogas reactor microbial communities from SLU, Sweden, that are enriched on cellulose - Sample No3 60kmer | Engineered | Open in IMG/M |
| 3300002898 | Metagenome Biopara biogasfermenter May 2013 pooled | Engineered | Open in IMG/M |
| 3300003667 | Lithgow State Coal Mine Metagenomic Study (LSCM 3 Late (Sample 2)) | Environmental | Open in IMG/M |
| 3300005835 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 1 to 3 kb reads | Engineered | Open in IMG/M |
| 3300006225 | Biogas reactor microbial communities from SLU, Alnarp, Sweden - PacBio 99 accuracy | Engineered | Open in IMG/M |
| 3300006398 | Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Cas_03_SludgeMetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300006483 | Microbial communities from pig manure storage tank from Sherbrooke, QC, Canada, enriched culture C4 | Engineered | Open in IMG/M |
| 3300006801 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 | Environmental | Open in IMG/M |
| 3300009122 | Syntrophic microbial communities from biogas reactors in Seattle, WA - R1.C13.But.B IBDA | Engineered | Open in IMG/M |
| 3300009607 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009642 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009647 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009652 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA | Engineered | Open in IMG/M |
| 3300009655 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG | Engineered | Open in IMG/M |
| 3300009656 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG | Engineered | Open in IMG/M |
| 3300009663 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG | Engineered | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300009668 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG | Engineered | Open in IMG/M |
| 3300009669 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG | Engineered | Open in IMG/M |
| 3300009670 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG | Engineered | Open in IMG/M |
| 3300009671 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1 time_0 SIP DNA | Engineered | Open in IMG/M |
| 3300009675 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG | Engineered | Open in IMG/M |
| 3300009682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC083_MetaG | Engineered | Open in IMG/M |
| 3300009685 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG | Engineered | Open in IMG/M |
| 3300009687 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC035_MetaG | Engineered | Open in IMG/M |
| 3300009688 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG | Engineered | Open in IMG/M |
| 3300009690 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC034_MetaG | Engineered | Open in IMG/M |
| 3300009693 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC097_MetaG | Engineered | Open in IMG/M |
| 3300009707 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU002_MetaG | Engineered | Open in IMG/M |
| 3300009715 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG | Engineered | Open in IMG/M |
| 3300009767 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG | Engineered | Open in IMG/M |
| 3300009770 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C12 SIP DNA | Engineered | Open in IMG/M |
| 3300009773 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_B C12 SIP DNA | Engineered | Open in IMG/M |
| 3300010340 | AD_USOAca | Engineered | Open in IMG/M |
| 3300010344 | AD_JPASca | Engineered | Open in IMG/M |
| 3300010353 | AD_USCAca | Engineered | Open in IMG/M |
| 3300010356 | AD_USDEca | Engineered | Open in IMG/M |
| 3300010357 | AD_USSTca | Engineered | Open in IMG/M |
| 3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014206 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 metaG | Engineered | Open in IMG/M |
| 3300015214 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R metaG | Engineered | Open in IMG/M |
| 3300025408 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from China - AD_SCU001_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025618 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC071_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025638 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025657 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC075_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025677 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025682 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025683 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC073_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025708 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC055_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025713 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025730 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC057_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025737 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025748 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC087_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300025784 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC033_MetaG (SPAdes) | Engineered | Open in IMG/M |
| 3300026194 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_A C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026195 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026250 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R1_B C12 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026255 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2_A C13 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300026311 | Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes) | Engineered | Open in IMG/M |
| 3300027510 | Biogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes) | Engineered | Open in IMG/M |
| 3300027711 | Agricultural soil microbial communities from Utah to study Nitrogen management - Steer compost 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300028570 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12 | Engineered | Open in IMG/M |
| 3300028576 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10 | Engineered | Open in IMG/M |
| 3300028602 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #3 | Environmental | Open in IMG/M |
| 3300028603 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 138R | Engineered | Open in IMG/M |
| 3300028633 | Enriched activated sludge microbial communities from anaerobic digester in WTTP, New Holstein, Wisconsin, United States - AAG_UR_Gly | Engineered | Open in IMG/M |
| 3300029775 | Liquor fermentation pit mud microbial communities from Luzhou, China - Meta-4-1-220-B | Engineered | Open in IMG/M |
| 3300029822 | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-3-30-T | Engineered | Open in IMG/M |
| 3300029824 | Liquor fermentation pit mud microbial communities from Chengdu, China - Meta-7-1-30-B | Engineered | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Draft_100165708 | 3300001592 | Hydrocarbon Resource Environments | GGPMKPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| JGI24707J26582_100847503 | 3300002163 | Biogas Fermentantion | MKPPRTLSISAALHSRLWLLKIRRKARTLDEVVEQALDALEEXEANXG* |
| JGI24707J26582_101712782 | 3300002163 | Biogas Fermentantion | MKSSRTLSVSAALHSRLWLLKIRRKARTLDEVIEQALDALEEQEANNG* |
| JGI24708J26588_101421001 | 3300002164 | Biogas Fermentantion | LSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| JGI24713J26584_100291333 | 3300002166 | Biogas Fermentantion | MTPPKTLSISAALHSRLWLLKIRRKARTLDEVIEQALDALEEQEVNNG* |
| JGI24713J26584_100480851 | 3300002166 | Biogas Fermentantion | MKPPRTLSISADLHTRLWLLKIRRNARTLEDVVEQALDALEEQEA |
| JGI24713J26584_101042762 | 3300002166 | Biogas Fermentantion | EPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANNG* |
| JGI24714J26587_100311134 | 3300002167 | Biogas Fermentantion | MKPPRTLSISADLHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| JGI24714J26587_100564761 | 3300002167 | Biogas Fermentantion | MKPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANNG* |
| JGI24712J26585_101313462 | 3300002168 | Biogas Fermentantion | PPRTLSISAALHSRLWLLKIRRKARTLDEVVEQALDALEAQEANDG* |
| JGI24712J26585_101963132 | 3300002168 | Biogas Fermentantion | MKPPRTLSVSAALHTRLWLLKIRRKARTLDEVVEQALDALEEQEADDG* |
| JGI24709J26583_100565513 | 3300002173 | Biogas Fermentantion | VKPPRTLSVSAALHSRLWLHKIRRKARTLDEVIEQALDALEEQEANDG* |
| JGI24709J26583_101245411 | 3300002173 | Biogas Fermentantion | VPVKPPRTLSVSAALHSRLWLLKIRRKARTLDEVVEQALDALEEQEANDG* |
| JGI24709J26583_102054221 | 3300002173 | Biogas Fermentantion | AGRGPARGDAEGGCPMKPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| JGI24710J26742_100917563 | 3300002174 | Biogas Fermentantion | MKPPRTLSXSAALHSRLWLLKIRRXARTLEDVVEQALDALEEQEAADE* |
| draft_14183974 | 3300002596 | Hydrocarbon Resource Environments | MKPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| bg3kmer60_10755853 | 3300002837 | Biogas Reactor | MKPPRTLSVSAALHSRLWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| draft_104825801 | 3300002898 | Biogas Fermenter | PMKPPRTLSISAALHTRLWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| LSCM3L_10392471 | 3300003667 | Coalbed Water | LSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0078910_1024696 | 3300005835 | Biogas Reactor | VKPPRTLSVSAALHSRLWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0082206_10205312 | 3300006225 | Mixed Substrate Biogas Reactor | VKPPRTLSVSAALXSRLWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0079067_10261903 | 3300006398 | Anaerobic Digestor Sludge | MKPPRTLSISAALHSRLWLLKIRRNARTLDEVVEQALDALEEQEANDG* |
| Ga0100240_1121698 | 3300006483 | Manure | MKPPRTLSVSAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0079223_102675963 | 3300006801 | Agricultural Soil | MKHPRTLSISAALHSRIWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0118674_10864022 | 3300009122 | Anaerobic Wastewater Sludge | VKPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0123327_11891992 | 3300009607 | Anaerobic Biogas Reactor | VKPPRTLSISAALHSRLWLLKIQRKARTLDEVVEQALDALEEREANDG* |
| Ga0123327_12148631 | 3300009607 | Anaerobic Biogas Reactor | ALHTRLWLLKIRRKARSLEDVVEQALDALEEQEANDG* |
| Ga0123331_12617211 | 3300009642 | Anaerobic Biogas Reactor | GPMKPPRTLSISAALHTRLWLLKIRRKARTLDEVIGQALDALEEQEANDG* |
| Ga0123326_10329771 | 3300009647 | Anaerobic Biogas Reactor | MKPPRTLSISAALHSRLWLLKIRRNARTLDEVVEQALDALEEREANDG* |
| Ga0123330_10303484 | 3300009652 | Anaerobic Biogas Reactor | VKPPRTLSISAALHSRIWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0123330_10891713 | 3300009652 | Anaerobic Biogas Reactor | AALHTRLWLLKIQRKARTLDEVVEQALDALEEQEANDG* |
| Ga0116190_12136702 | 3300009655 | Anaerobic Digestor Sludge | MKPPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDALEEQEGNDG* |
| Ga0123329_11309631 | 3300009656 | Anaerobic Biogas Reactor | PMKPPRTLSISAALHSRLWLLKIRRNARTLDEVVEQALDALEEQEANDG* |
| Ga0123329_12811862 | 3300009656 | Anaerobic Biogas Reactor | VKPPRTLSVSAPLHSRLWLLKIRRKARTLDEVIEQALDALEEQEGNNG* |
| Ga0116179_11630212 | 3300009657 | Anaerobic Digestor Sludge | MKPLRTLSISAALHSRLWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0116179_12118081 | 3300009657 | Anaerobic Digestor Sludge | MKPPRTLSISAALHSRLWLLKIRRNARTLEDVIEQALDALEEQEANDG* |
| Ga0116179_12196171 | 3300009657 | Anaerobic Digestor Sludge | GCPMKPPRTLSVSAALHSRIWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0116179_12683942 | 3300009657 | Anaerobic Digestor Sludge | VKPPRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0116181_12272223 | 3300009663 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRLWLLKIRRKARTIDEVIEQALDALEEQE |
| Ga0116182_11503454 | 3300009666 | Anaerobic Digestor Sludge | MKPPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDALEEQEANDG* |
| Ga0116180_10514532 | 3300009668 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRLWLLKIRRKARTLDEVIEQALDALEEQEASNG* |
| Ga0116148_10424473 | 3300009669 | Anaerobic Digestor Sludge | SAALHSRIWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0116183_11026144 | 3300009670 | Anaerobic Digestor Sludge | MKPPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDALEEREANDG* |
| Ga0116183_13042102 | 3300009670 | Anaerobic Digestor Sludge | VKPPRTLSISADLHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0123334_10712372 | 3300009671 | Anaerobic Biogas Reactor | MKPPRTLSISAALHTRLWLLKIRRKARTLDEVIGQALDALEEQEANDG* |
| Ga0116149_11225373 | 3300009675 | Anaerobic Digestor Sludge | MTTPPAPTSDDGLVTVKPPRTLSISAALHSRIWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0116149_12041503 | 3300009675 | Anaerobic Digestor Sludge | MKPPRTLSISAALHTRLWLLKIRRNARTLEDVIEQALDALEEQEANDG* |
| Ga0116172_101769111 | 3300009682 | Anaerobic Digestor Sludge | PPAPTSDDGLVTVKPPRTLSISAALHSRLWLLKIQRKARTLDEVVEQALDALEEQEANDG |
| Ga0116142_101244983 | 3300009685 | Anaerobic Digestor Sludge | MTTPPAPTSDDGLVTVKPPRTLSISAALHTRIWLIKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0116144_101832731 | 3300009687 | Anaerobic Digestor Sludge | MKPPRTLSISAALHTRIWLIKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0116176_102120753 | 3300009688 | Anaerobic Digestor Sludge | MKPPRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEVNDG* |
| Ga0116143_103922831 | 3300009690 | Anaerobic Digestor Sludge | MTTPPAPTSDDGLVTVKPPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDALEEREANDG* |
| Ga0116141_101910122 | 3300009693 | Anaerobic Digestor Sludge | VKPPRTLSVSAALHTRLWLLKIRRKARSLEDVVEQALDALEEQEANDG* |
| Ga0116195_10079457 | 3300009707 | Anaerobic Digestor Sludge | MKPPRTLSVSSALHSRLWLLKIRRKARTLDEVIEQALDALEEQEANDG* |
| Ga0116160_10784803 | 3300009715 | Anaerobic Digestor Sludge | MTSPPRTLQVSGDLHTRIWLLKIRRGARTLNEVIEDALDALESVKGDDL* |
| Ga0116160_13109921 | 3300009715 | Anaerobic Digestor Sludge | GCPVKPPRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0116161_11009453 | 3300009767 | Anaerobic Digestor Sludge | MKPPRTLSISAALHARLWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0123332_12308313 | 3300009770 | Anaerobic Biogas Reactor | MKPPRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDAL |
| Ga0123333_100900703 | 3300009773 | Anaerobic Biogas Reactor | VKPPRTLSISAALHTRLWLLKIQRKARTLDEVVEQALDALEEQEANDG* |
| Ga0123333_102280031 | 3300009773 | Anaerobic Biogas Reactor | LHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0123333_102790251 | 3300009773 | Anaerobic Biogas Reactor | SAALHTRLWLLKIRRKARTLDEVIEQALDALEEQEANDG* |
| Ga0116250_102313002 | 3300010340 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRIWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0116250_103822634 | 3300010340 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRLWLLKIRRKARTLDEVIEQALDAL |
| Ga0116250_103861022 | 3300010340 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRLWLLKIRRRARTLDEVIEQALDALEEQEANDG* |
| Ga0116250_105022462 | 3300010340 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRLWLLKIRRKARTIDEVIEQALDALEEQEANDG* |
| Ga0116243_105363053 | 3300010344 | Anaerobic Digestor Sludge | MKPPRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEE |
| Ga0116236_101945632 | 3300010353 | Anaerobic Digestor Sludge | VKPPRTLSVSAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG* |
| Ga0116237_113006541 | 3300010356 | Anaerobic Digestor Sludge | SRIWLLKIRRNARTLEDVVEQALDALEEQEGNDG* |
| Ga0116249_112796002 | 3300010357 | Anaerobic Digestor Sludge | RTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEVNDG* |
| Ga0172378_100790126 | 3300014203 | Groundwater | MKPPRTLSISADLHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDE* |
| Ga0172378_101014041 | 3300014203 | Groundwater | VKPPRTLSISAALHSRIWLLKIQRKARTLDEVVEQALDALEEREANDG* |
| Ga0172381_111974611 | 3300014204 | Landfill Leachate | MKPPRTLSISAALHSRLWLLKIRRKARTLDEVVEQALDALEER |
| Ga0172381_114202992 | 3300014204 | Landfill Leachate | VKPPRTLSISASLHSRIWLLKIQRKARTLDEVVEQALDALEEREADDG* |
| Ga0172380_101442461 | 3300014205 | Landfill Leachate | MKPPRTLSISAALHSRLWLLKIQRKARTLDEVVEQALDALEEQEGNDG* |
| Ga0172377_102042832 | 3300014206 | Landfill Leachate | VKPPRTLSISAALHSRIWLLKIRRRARTLDEVVEQALDALEEREANDG* |
| Ga0172377_104700284 | 3300014206 | Landfill Leachate | MKPPRTLSISADLHTRLWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0172377_104909163 | 3300014206 | Landfill Leachate | MKPPRTLSISAALHSRIWLLKIRRKARTLDEVVEQALDALEEQEGNDG* |
| Ga0172377_105479083 | 3300014206 | Landfill Leachate | MKPPRTLSISAALHSRIWLLKIRRRARTLDEVVEQALDPLEEREAKP* |
| Ga0172377_110180212 | 3300014206 | Landfill Leachate | MKPPRTLSISAALHTRLWLLKIRRKARTLEDVVEQALDALEEQEANDG* |
| Ga0172377_113678503 | 3300014206 | Landfill Leachate | MKPPRTLSVSAALHSRLWLLKIRRNARTLEDVVEQALDALEE |
| Ga0172377_114939093 | 3300014206 | Landfill Leachate | MTPPKTLSISAALHTRLWLLKIRRKARTFDEVIEQALDAL |
| Ga0172382_106432991 | 3300015214 | Landfill Leachate | LSISAALHSRIWLLKIRRKARTLDEVVEQALDALEEQEANDG* |
| Ga0172382_107176291 | 3300015214 | Landfill Leachate | FGVEPRLEALMTPPKTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEREANDG* |
| Ga0172382_108728843 | 3300015214 | Landfill Leachate | MRPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALE |
| Ga0208462_10378363 | 3300025408 | Anaerobic Digestor Sludge | MKPPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDA |
| Ga0208693_10389433 | 3300025618 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRIWLLKIRRKARTLEDVVEQALDALEEQEANDG |
| Ga0208693_10882731 | 3300025618 | Anaerobic Digestor Sludge | GGCPMKPPRTLSVSAALHSRIWLLKIRRKARTLEDVVEQALDALEEQEANDG |
| Ga0208693_11412332 | 3300025618 | Anaerobic Digestor Sludge | VKPPRTLSVSAALHSRLWLLKIRRKARTLDEVIEQALDALEEQEGNNG |
| Ga0208693_11427991 | 3300025618 | Anaerobic Digestor Sludge | MKPPRTLSISAALHSRLWLLKIRRNARTLEDVIEQALDAL |
| Ga0208693_11817452 | 3300025618 | Anaerobic Digestor Sludge | PPRTLSISAALHTRLWLLKIRRNARTLEDVIEQALDALEEQEANDG |
| Ga0208198_10297893 | 3300025638 | Anaerobic Digestor Sludge | MKPPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDALEEQEGNDG |
| Ga0208823_10229016 | 3300025657 | Anaerobic Digestor Sludge | ALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0208823_10804793 | 3300025657 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRLWLLKIRRRARTLDEVIEQALDALEEQEANDG |
| Ga0208823_11384331 | 3300025657 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRLWLLKIRRKARTIDEVIEQALDALEEQEANDG |
| Ga0208823_11606072 | 3300025657 | Anaerobic Digestor Sludge | AALHSRIWLLKIRRKARTLEDVVEQALDALEEQEANDG |
| Ga0209719_10210485 | 3300025677 | Anaerobic Digestor Sludge | MTSPPRTLQVSGDLHTRIWLLKIRRGARTLNEVIEDALDALESVKGDDL |
| Ga0209719_11685882 | 3300025677 | Anaerobic Digestor Sludge | PPRTLSISAALHARLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0209718_11154031 | 3300025682 | Anaerobic Digestor Sludge | MKPPRTLSISAALHARLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0208564_10178883 | 3300025683 | Anaerobic Digestor Sludge | MKPPRTLSISAALHSRLWLLKIRRNARTLEDVIEQALDALEEQEANDG |
| Ga0208564_10700282 | 3300025683 | Anaerobic Digestor Sludge | MKPPRTLSVSAALHSRLWLLKIRRKARTLDEVIEQALDALEEQEASNG |
| Ga0208564_11078053 | 3300025683 | Anaerobic Digestor Sludge | SVSAALHSRIWLLKIRRKARTLEDVVEQALDALEEQEANDG |
| Ga0208564_11557552 | 3300025683 | Anaerobic Digestor Sludge | VKPPRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0209201_10481014 | 3300025708 | Anaerobic Digestor Sludge | MTTPPAPTSDDGLVTVKPPRTLSISAALHSRIWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0208195_11957022 | 3300025713 | Anaerobic Digestor Sludge | MKPPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDALEEQEANDG |
| Ga0209606_12531852 | 3300025730 | Anaerobic Digestor Sludge | MTPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDALEEQEANDG |
| Ga0208694_12394612 | 3300025737 | Anaerobic Digestor Sludge | VKPPRTLSISADLHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0208459_11740212 | 3300025748 | Anaerobic Digestor Sludge | MKPPRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0209200_11373603 | 3300025784 | Anaerobic Digestor Sludge | DDGLVTVKPPRTLSISAALHSRIWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0209509_11447942 | 3300026194 | Anaerobic Biogas Reactor | VKPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0209312_11120432 | 3300026195 | Anaerobic Biogas Reactor | AALHSRLWLLKIQRKARTLDEVVEQALDALEEREANDG |
| Ga0209612_11235682 | 3300026250 | Anaerobic Biogas Reactor | MKPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0209613_10284634 | 3300026255 | Anaerobic Biogas Reactor | VKPPRTLSISAALHSRIWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0209723_11150843 | 3300026311 | Anaerobic Biogas Reactor | SISAALHTRLWLLKIQRKARTLDEVVEQALDALEEQEANDG |
| Ga0209537_100101110 | 3300027510 | Biogas Fermentantion | MTPPKTLSISAALHSRLWLLKIRRKARTLDEVIEQALDALEEQEVNNG |
| Ga0209537_10147725 | 3300027510 | Biogas Fermentantion | MKPPRTLSISADLHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0209537_10650651 | 3300027510 | Biogas Fermentantion | RGGPMKPPRTLSISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANNG |
| Ga0209075_12678502 | 3300027711 | Agricultural Soil | MKPPRTLSISAALHTRLWLLKIRRKARTLEDVVEQALDALEEQEANDG |
| (restricted) Ga0255341_12575831 | 3300028570 | Wastewater | GGSMKPLRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| (restricted) Ga0255340_11453993 | 3300028576 | Wastewater | MKPLRTLSISAALHSRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| (restricted) Ga0255340_11881943 | 3300028576 | Wastewater | PPRTLSVSAALHTRLWLLKIRRKARTIDEVIEQALDALEEQEANDG |
| Ga0265294_103832913 | 3300028602 | Groundwater | VKPPRTLSISAALHSRIWLLKIRRRARTLDEVVEQALDPLEEREAKP |
| Ga0265294_105685502 | 3300028602 | Groundwater | VKPPRTLSISASLHSRIWLLKIRRRARTLDEVVEQALDALEEQEGNDG |
| Ga0265294_106060692 | 3300028602 | Groundwater | VKTPRTLSVSAALHSRIWLLKIQRKARTLDEVVEQALDALEEREANDG |
| Ga0265294_107810642 | 3300028602 | Groundwater | MKPPRTLSISAALHSRIWLLKIRRRARTLDEVVEQ |
| Ga0265293_103134461 | 3300028603 | Landfill Leachate | SISAALHTRLWLLKIRRNARTLEDVVEQALDALEEQEANDG |
| Ga0302236_11183022 | 3300028633 | Activated Sludge | VKPPRTLSISAALHTRLWLLKIRRKARTLDEVIEQALDALEEQEANDG |
| Ga0134843_10039484 | 3300029775 | Fermentation Pit Mud | MKPPRTLSVSAALHSRLWLLKIRRKARTLDEVIEQALDALEEQEANDG |
| Ga0134854_10119914 | 3300029822 | Fermentation Pit Mud | MKPPRTLSVSAALHSRLWLLKIRRRARTLDEVVEQALDALEEQEANDG |
| Ga0134852_1014073 | 3300029824 | Fermentation Pit Mud | MKPLRTLSVSAALHSRLWLHKIRRRARTLDEVVEQALDALEEQEANDG |
| ⦗Top⦘ |