 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F063389 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 129 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 129 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 15.50 % |
| % of genes near scaffold ends (potentially truncated) | 47.29 % |
| % of genes from short scaffolds (< 2000 bps) | 96.12 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.721 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater (38.760 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.512 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.845 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 82.22% β-sheet: 0.00% Coil/Unstructured: 17.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 129 Family Scaffolds |
|---|---|---|
| PF00510 | COX3 | 57.36 |
| PF02790 | COX2_TM | 22.48 |
| PF00116 | COX2 | 15.50 |
| PF13510 | Fer2_4 | 1.55 |
| PF00361 | Proton_antipo_M | 0.78 |
| PF00346 | Complex1_49kDa | 0.78 |
| PF00037 | Fer4 | 0.78 |
| PF01425 | Amidase | 0.78 |
| COG ID | Name | Functional Category | % Frequency in 129 Family Scaffolds |
|---|---|---|---|
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 57.36 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 37.98 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 15.50 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.78 |
| COG0649 | NADH:ubiquinone oxidoreductase 49 kD subunit (chain D) | Energy production and conversion [C] | 0.78 |
| COG3261 | Ni,Fe-hydrogenase III large subunit | Energy production and conversion [C] | 0.78 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.72 % |
| All Organisms | root | All Organisms | 16.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 38.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 9.30% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.75% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 7.75% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.20% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.88% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.88% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.55% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.55% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.78% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.78% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.78% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003684 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300004766 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004769 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004787 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004794 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300007321 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009233 | Microbial communities of water from Amazon river, Brazil - RCM9 | Environmental | Open in IMG/M |
| 3300009239 | Microbial communities of water from Amazon river, Brazil - RCM11 | Environmental | Open in IMG/M |
| 3300009243 | Microbial communities of water from Amazon river, Brazil - RCM13 | Environmental | Open in IMG/M |
| 3300009247 | Microbial communities of water from Amazon river, Brazil - RCM14 | Environmental | Open in IMG/M |
| 3300009257 | Microbial communities of water from Amazon river, Brazil - RCM22 | Environmental | Open in IMG/M |
| 3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300012705 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES047 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012746 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES049 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012755 | Freshwater microbial communities from Lake Montjoie, Canada - M_140807_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012763 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012768 | Freshwater microbial communities from Lake Montjoie, Canada - M_130710_M_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012769 | Freshwater microbial communities from Lake Montjoie, Canada - M_140205_X_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012962 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013076 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES042 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300016697 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019201 | Estuarine microbial communities from the Columbia River estuary - R6.10AS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019207 | Estuarine microbial communities from the Columbia River estuary - R.871 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020167 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021093 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surface | Environmental | Open in IMG/M |
| 3300021282 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1035 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021296 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R881 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021299 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1034 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021312 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1072 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
| 3300021847 | Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1070 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023700 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024280 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d | Environmental | Open in IMG/M |
| 3300024307 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepC_8d | Environmental | Open in IMG/M |
| 3300024312 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepA_8d | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024483 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024535 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024539 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024548 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024554 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024561 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024569 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024574 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025743 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025745 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025756 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025760 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025763 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026402 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026425 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026435 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026564 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026565 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026571 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300028088 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028100 | Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Atlam_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028112 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028255 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300028257 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029697 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J40625_1000307359 | 3300002835 | Freshwater | MQIGWLQILVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| B570J40625_1002384752 | 3300002835 | Freshwater | MQIGWLQIVVIGLVVLILFGKLPNIIQDVKSAYLELSKKNEEKNK* |
| B570J40625_1002932292 | 3300002835 | Freshwater | MQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| B570J40625_1015163311 | 3300002835 | Freshwater | MQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK* |
| B570J40625_1016030442 | 3300002835 | Freshwater | MQIGWLQIVVIGLLILVLFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0005851_10507162 | 3300003684 | Freshwater And Sediment | MQIGWLQIVVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0005851_10514581 | 3300003684 | Freshwater And Sediment | WLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0007787_106005382 | 3300004240 | Freshwater Lake | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNEEKDK* |
| Ga0007747_14275311 | 3300004766 | Freshwater Lake | GWLQIVVIGLLILVLFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0007748_115846462 | 3300004769 | Freshwater Lake | MQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKNK* |
| Ga0007755_15762651 | 3300004787 | Freshwater Lake | YIKMQIGWLQILVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0007760_100443142 | 3300004793 | Freshwater Lake | MQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQ |
| Ga0007751_100337961 | 3300004794 | Freshwater Lake | KIMQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQRDK* |
| Ga0078894_102272782 | 3300005662 | Freshwater Lake | MQIGWLQILVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0102692_16159321 | 3300007321 | Freshwater Lake | IVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0102919_10498682 | 3300007597 | Estuarine | MQIGWLQIVVIGLVVLFLFGKLPNIIQDVKSAYLELSKKNEEKNK* |
| Ga0114344_11096951 | 3300008111 | Freshwater, Plankton | MQIGWLQIVVIGLVVLVLFGLLPNIIQDIKSAYLE |
| Ga0114346_12047211 | 3300008113 | Freshwater, Plankton | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNEEKD |
| Ga0114978_100542574 | 3300009159 | Freshwater Lake | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKDEEKNK* |
| Ga0114970_103900631 | 3300009163 | Freshwater Lake | RITMQIGWLQIVVIGLVVLILFGKLPNIIQDVKSAYLELSKKNEEKNK* |
| Ga0114974_105764982 | 3300009183 | Freshwater Lake | MQIGWLQIVVIGLLILVLFGKLPNIIQDLKSAYLELSKKDEEKNK* |
| Ga0103856_100272953 | 3300009233 | River Water | MQIGWLQIIVIGVVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0103858_100111053 | 3300009239 | River Water | MQIGWLQIIVIGVVVLLLFGKLPNIIQDLKSAYLEVSKKKEEKEK* |
| Ga0103858_100529162 | 3300009239 | River Water | MQIGWLQIVVIGLVVLLLFGKLPNIIQDLKSAYLEISKKNEEKGK* |
| Ga0103860_100079162 | 3300009243 | River Water | MQIGWLQIIVIGVVVLLLFGKLPDIIQDPKSAYLEVSKKKEEKEK* |
| Ga0103860_100132802 | 3300009243 | River Water | MQIGWLQIVVIGFVILLLFGKLPNIIQDVKSAYLELSKKNEEKNK* |
| Ga0103860_100889052 | 3300009243 | River Water | MQIGWLQIVVIGLVVLILFGKLPNIIHDLKSAYLELSKKNEEKDK* |
| Ga0103861_100194962 | 3300009247 | River Water | MQIGWLQIIVIGVVVLLLFGKLPDIIQDLKSAYLEVSKKKEEKEK* |
| Ga0103861_100227202 | 3300009247 | River Water | MQIGWLQIVVIGFVILLLFGRLPNIIQDVKSAYLELSKKNEEKNK* |
| Ga0103869_100188741 | 3300009257 | River Water | MQIGWLQIVVIGLVVLLLFGKLPDIIQDLKSTYLELTKKNEEKEK* |
| Ga0103869_100699691 | 3300009257 | River Water | WLQIIVIGVVVLLLFGKLPDIIQDLKSAYLEVSKKKEEKEK* |
| Ga0102688_10709752 | 3300011381 | Freshwater Lake | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEIS |
| Ga0157555_10426291 | 3300012705 | Freshwater | WLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK* |
| Ga0157608_11043481 | 3300012709 | Freshwater | MQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELS |
| Ga0157606_12542322 | 3300012733 | Freshwater | MQIGWLQIVVIGLVVLILFGKLPNIIQDVKSAYLELSKKDEEKNK* |
| Ga0157556_1438611 | 3300012746 | Freshwater | IMQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKNK* |
| Ga0138281_11806412 | 3300012755 | Freshwater Lake | MQIGWLQIVVIGLVVLILFGKLPNIIQVVKSAYLELSKKNEEKNK* |
| Ga0157626_10260671 | 3300012759 | Freshwater | TNYIGRLKIMQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK* |
| Ga0138289_11759641 | 3300012763 | Freshwater Lake | MQIGWLQILVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEERDK* |
| Ga0138276_10405162 | 3300012768 | Freshwater Lake | MQIGWLQIVVIVLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK* |
| Ga0138276_12455862 | 3300012768 | Freshwater Lake | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLE |
| Ga0138279_10349873 | 3300012769 | Freshwater Lake | MQIGWLQIVVIGLVVLLLFGKLPNIIQDVKSAYLELSKKNEEKNK* |
| Ga0138279_11297462 | 3300012769 | Freshwater Lake | MQIGWLQIVVIGLLVLLLFGKLPNIIQDLKSAYLELSKKDEEKNK* |
| Ga0138279_11579364 | 3300012769 | Freshwater Lake | MQIGWLQIFVIGLLVLVLFGKLPNIIQDLKSAYLELSKKDEEKNK* |
| Ga0138283_11123821 | 3300012774 | Freshwater Lake | MQIGWIQIVVIGLVVLILFGKLPNINQDVKSASLELSKKNEEKNK* |
| Ga0129335_11424992 | 3300012962 | Aqueous | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKSEEKDK* |
| Ga0129338_12115772 | 3300012970 | Aqueous | AMQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNEEKDK* |
| Ga0129338_12332722 | 3300012970 | Aqueous | MQIGWLQILVIGLVVLILFGKLPNIIQDLKSAYLELYKKNEEKDK* |
| Ga0129338_15527162 | 3300012970 | Aqueous | LNGKMQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK* |
| Ga0157551_10196211 | 3300013076 | Freshwater | QIGWLQIVVIGLVVLILFGKLPNIIQDVKSAYLELSKKNEEKNK* |
| Ga0170791_105304933 | 3300013295 | Freshwater | MQIGWLQIVVIGLVVLLLFGKLPNVIQDVKSAYLEFSKKNEEKNN* |
| Ga0170791_134526312 | 3300013295 | Freshwater | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNE |
| Ga0180057_11866652 | 3300016697 | Freshwater | CLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0169931_107983302 | 3300017788 | Freshwater | MQIGWLQIVVIGFVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0180032_10690961 | 3300019201 | Estuarine | IAMQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0180032_11105522 | 3300019201 | Estuarine | MQIGWLQILVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0180034_11565002 | 3300019207 | Estuarine | MQIGWLQIVVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0211733_104425821 | 3300020160 | Freshwater | MQIGWLQIFVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0211726_102181501 | 3300020161 | Freshwater | KMQIGWLQILVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0194035_11027622 | 3300020167 | Anoxic Zone Freshwater | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKDEEKNK |
| Ga0194118_101513732 | 3300020190 | Freshwater Lake | MQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKSEEKDK |
| Ga0211731_105376742 | 3300020205 | Freshwater | MQIGWLQIIVIGLVVLVLFGKLPTIIQDVKSAYLEFSKKNEEKNK |
| Ga0194133_105409992 | 3300021091 | Freshwater Lake | MQIGWLQIIVIGVVVLILFGKLPNIIQDLKSAYLELSKKNEEKNK |
| Ga0194122_104327012 | 3300021092 | Freshwater Lake | MQIGWLQIVVIGLVVLLLFGKLPNIIQDLKSAYLELSKKNEEKEK |
| Ga0194123_102757732 | 3300021093 | Freshwater Lake | MQIGWLQIVVIGLVVLLLFGKLPDIIQDLKSTYLELTKKNEEKEK |
| Ga0210303_11116892 | 3300021282 | Estuarine | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNGEKDK |
| Ga0210300_1638052 | 3300021296 | Estuarine | MQIGLLQILVIGLVVLILFGKLPNIIQVLKSAYLELSKKN |
| Ga0210302_10173611 | 3300021299 | Estuarine | KIMQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0210302_10814341 | 3300021299 | Estuarine | MQIGWLQIVVIGLLILVLFGKLPNIIQDLKSAYLELSKKN |
| Ga0210306_11416623 | 3300021312 | Estuarine | QIGWLQILVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0194130_100191668 | 3300021376 | Freshwater Lake | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNEEKDK |
| Ga0194130_102062102 | 3300021376 | Freshwater Lake | QIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0194130_102898722 | 3300021376 | Freshwater Lake | MQIGWLQIIVIGVVVLILFGKLPNIIQDLKSAYLELSKKSEEKDK |
| Ga0210305_10230321 | 3300021847 | Estuarine | MQIGWLQIVVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNE |
| Ga0222712_106187152 | 3300021963 | Estuarine Water | NQEEIAMQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0228707_10382061 | 3300023700 | Freshwater | MQIGWLHIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKD |
| Ga0255209_100071716 | 3300024280 | Freshwater | MQIGWLQIIVIGVVVLLLFGKLPNIIQDLKSAYLEVSKKKEEKEK |
| Ga0255209_10566992 | 3300024280 | Freshwater | QIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0255221_10353302 | 3300024307 | Freshwater | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0255219_10170412 | 3300024312 | Freshwater | MQIGWLQIVVIGLVVLLLFDKLPNIIQDLKSAYLELSKKNEEKEK |
| Ga0244776_105224632 | 3300024348 | Estuarine | MQIGWLQILVIGLVVLVLFGKLPNIIQDLKSAYLELSK |
| Ga0255223_10195092 | 3300024480 | Freshwater | GRLKIMQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0255224_10440071 | 3300024483 | Freshwater | WLQIVVIGLVVLLLFGKLPNIIQDLKSAYLEISKKNEEKGK |
| Ga0255224_10592202 | 3300024483 | Freshwater | MQIGWLQIVVIGLVVLVLFGKLPNIIQDLKSAYLELSKKN |
| Ga0256299_10243902 | 3300024533 | Freshwater | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNEEKGK |
| Ga0255303_10364982 | 3300024535 | Freshwater | MQIGCLQIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0255303_10391112 | 3300024535 | Freshwater | MQIGWLQIVVIGLVVLLLFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0255225_10357871 | 3300024537 | Freshwater | KITMQIGWLQIVVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0255231_10158312 | 3300024539 | Freshwater | MQIGWLQIVVIGLVVLLLFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0255231_10635212 | 3300024539 | Freshwater | RLKIMQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0256342_10136672 | 3300024548 | Freshwater | MQIGWFQIVVIGLVVLLLFGKLPNIIQDLKSAYLEISKKNEEKGK |
| Ga0256342_11024212 | 3300024548 | Freshwater | MQIGWLQIVVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEK |
| Ga0255242_10474751 | 3300024554 | Freshwater | YIKMQIGWLQIFVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0255283_11224732 | 3300024557 | Freshwater | MQIGWLQIVVIGLLVLILFGNLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0255288_10487792 | 3300024561 | Freshwater | MQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKKEEKDK |
| Ga0255243_10268402 | 3300024569 | Freshwater | MQIGWLQIVVIGILVLVLFGKLPNIIQDLKSAYLEISKKNEEKDK |
| Ga0255275_10924342 | 3300024574 | Freshwater | MQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEE |
| Ga0255275_11118532 | 3300024574 | Freshwater | TMQIGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0255246_10521912 | 3300024863 | Freshwater | IGWLQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0256321_1024202 | 3300025743 | Freshwater | MQIGWLQIVVIVLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0256321_1212601 | 3300025743 | Freshwater | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKD |
| Ga0255244_10268442 | 3300025745 | Freshwater | MQIGWLQILVIGLVVLILFGKLPNIIQDLKSAYLELSKK |
| Ga0255239_10688412 | 3300025756 | Freshwater | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNEQKDK |
| Ga0255249_10312062 | 3300025760 | Freshwater | MQIGWLQILVIGLVVLILFGKLPNIIQDLKSAYLELSKKNE |
| Ga0255250_10502152 | 3300025763 | Freshwater | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKDE |
| Ga0255250_10994602 | 3300025763 | Freshwater | FYIGKQKIMQIWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0255304_10003226 | 3300026402 | Freshwater | MQIGWLQIIVIGVVVLLLFGKLPDIIQDLKSAYLEVSKKKEEKEK |
| Ga0255304_10049112 | 3300026402 | Freshwater | MQIGWLQIVVIGLVVLLLFGKLPNIIQDLKSAYLEISKKNEEKGK |
| Ga0256298_10148582 | 3300026415 | Freshwater | MQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDN |
| Ga0256300_10428412 | 3300026425 | Freshwater | MQIGLLQIVVIGLLVLVLFGKLPNIIQDLKSAYLEISKKNEEKDK |
| Ga0256297_10139942 | 3300026435 | Freshwater | MQIGRLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0256359_11058702 | 3300026564 | Freshwater | MQIGWLQIIVIGVVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0256311_10493212 | 3300026565 | Freshwater | VIGLVVLILFGKLPNIIQDVKSAYLELSKKKEEKNK |
| Ga0255274_11495862 | 3300026570 | Freshwater | VIGLVDLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0255289_10485361 | 3300026571 | Freshwater | PHVQIVVIGLVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0255289_11570662 | 3300026571 | Freshwater | MQIGWLQIVVIGLVVLVLFGKLPNIIQDLKSAYLELSKKK |
| Ga0255070_10725531 | 3300027133 | Freshwater | MQIGWLQILVIGLVVLILFGKLPNIIQDLKSAYLELSK |
| Ga0255082_10078621 | 3300027139 | Freshwater | MQIGWLQIVVIGLVVLILFGKLPNIIQDVKSAYLE |
| Ga0209190_12365831 | 3300027736 | Freshwater Lake | RITMQIGWLQIVVIGLVVLILFGKLPNIIQDVKSAYLELSKKNEEKNK |
| Ga0209770_103545491 | 3300027769 | Freshwater Lake | IKMQIGWLQILVIGLVVLVLFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0255251_10457792 | 3300028088 | Freshwater | WLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0256363_10072832 | 3300028100 | Freshwater | MQIGGLQIVVIGLVVLLLFGKLPNIIQDLKSAYLEISKKNEEKGK |
| Ga0256335_10784621 | 3300028112 | Freshwater | WLQIIVIGVVVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0256335_11121312 | 3300028112 | Freshwater | IGLVVLLLFGKLPDIIQDLKSTYLELTKKNEEKEK |
| Ga0255226_10138812 | 3300028255 | Freshwater | MQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNE |
| Ga0255257_10199392 | 3300028257 | Freshwater | RQKIMQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0255257_10204262 | 3300028257 | Freshwater | MQIGWLQIVVIGLLILVLFGKLPNIIQDLKSAYLELSKKNEQKDK |
| Ga0256301_10253232 | 3300029697 | Freshwater | MQIGWLQIVVIGLLVLILFGKLPNIIQDLKSAYLELSKKNEEKDK |
| Ga0256301_10418822 | 3300029697 | Freshwater | MQIGWLQIVVIGLLVLVLFGKLPNIIQDLKSAYLELSKKNEEKNK |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |